Property Summary

NCBI Gene PubMed Count 41
PubMed Score 17.09
PubTator Score 24.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 9.2e-05
ovarian cancer 8491 4.9e-04
acute myeloid leukemia 785 3.8e-03
osteosarcoma 7933 4.7e-03
Disease Target Count Z-score Confidence
Breast cancer 3098 3.218 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.190 4.7e-03
tuberculosis and treatment for 6 months 1.300 9.2e-05
acute myeloid leukemia 1.700 3.8e-03
ovarian cancer -1.100 4.9e-04

Gene RIF (35)

PMID Text
26658611 villin directly interacts with a transcriptional corepressor and ligand of the Slug promoter, ZBRK1.
25749518 ZBRK1 suppresses renal cancer progression perhaps by regulating VHL expression through formation of a complex with VHL and p300 in renal cancer
25107531 MAGE proteins bind to KAP1, a gene repressor and ubiquitin E3 ligase which also binds KRAB domain containing zinc finger transcription factors (KZNFs), and MAGE expression may affect KZNF mediated gene regulation.
24924633 The secondary structure of the ZBRK1-DNA complex is found to be significantly altered from the standard B-DNA conformation.
23991171 results indicate that a loss of ZBRK1 contributes to the increased expression of KAP1, potentiating its role to enhance metastasis and invasion
23151675 promoter assays in two breast cancer cell lines identified two haplotypes (H11 and H12) stimulating significantly the expression of ZNF350 transcript compared with the common haplotype H8
22975076 ZBRK1 negatively regulates the HIV-1 LTR
21791101 high levels of gene activity in the genomic environment and the pre-deposition of repressive histone marks within a gene increase its susceptibility to KRAB/KAP1-mediated repression
20926453 KRAB-containing zinc-finger transcriptional regulator, ZBRK1, an interaction partner of the SCA2 gene product ataxin-2.
20713352 RB.E2F1 complex plays a critical role in ZBRK1 transcriptional repression, and loss of this repression may contribute to cellular sensitivity of DNA damage, ultimately leading to carcinogenesis.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20306497 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20221260 KRAB/KAP1 recruitment induces long-range repression through the spread of heterochromatin.
20150366 Observational study of gene-disease association. (HuGE Navigator)
20007691 Data found that HMGA2, along with a dozen of other genes, was co-repressed by ZBRK1, BRCA1, and CtIP.
19996286 Our findings suggest that ZBRK1 acts to inhibit metastasis of cervical carcinoma, perhaps by modulating MMP9 expression.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19484476 BRCA1 and ZNF350 may jointly contribute to individuals' susceptibility of breast cancer in Chinese women.
19484476 Observational study of gene-disease association. (HuGE Navigator)
19279087 KRAB/KAP1 regulation is fully functional within the context of episomal DNA
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17764113 Observational study of gene-disease association. (HuGE Navigator)
17764113 Genetic variants and haplotypes of the ZBRK1 gene is associated with breast and ovarian cancer
17557904 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16997916 KRAB-induced transcriptional repression is robust and active over a variety of genomic contexts that include at least the wide range of sites targeted by lentiviral integration
16485136 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15596820 interacts with BBLF2/3 to provide a tethering point on oriLyt for the EBV replication complex
15496401 the CTRD is a novel protein interaction surface responsible for directing homotypic and heterotypic interactions necessary for ZBRK1-directed transcriptional repression
15113441 Observational study of gene-disease association. (HuGE Navigator)
14660588 ZBRK1 zinc fingers have dual roles in sequence-specific DNA-binding and BRCA1-dependent transcriptional repression
14517299 ZBRK1 is a novel target for DNA damage-induced degradation
12872252 ZBRK1 mutation found in BRCA1 and BRCA2 mutation negative probands with breast or ovarian cancer.

AA Sequence

MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIE      1 - 70
DGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNL     71 - 140
TLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSE    141 - 210
CGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIH    211 - 280
QKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSE    281 - 350
CGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH    351 - 420
KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQP    421 - 490
VVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP                                491 - 532
//

Text Mined References (44)

PMID Year Title
26658611 2016 By moonlighting in the nucleus, villin regulates epithelial plasticity.
25749518 2015 ZBRK1, a novel tumor suppressor, activates VHL gene transcription through formation of a complex with VHL and p300 in renal cancer.
25107531 2014 MAGE proteins regulate KRAB zinc finger transcription factors and KAP1 E3 ligase activity.
24924633 2014 Tetrameric ZBRK1 DNA binding domain has affinity towards cognate DNA in absence of zinc ions.
23991171 2013 Loss of ZBRK1 contributes to the increase of KAP1 and promotes KAP1-mediated metastasis and invasion in cervical cancer.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
23151675 2013 Analysis of ZNF350/ZBRK1 promoter variants and breast cancer susceptibility in non-BRCA1/2 French Canadian breast cancer families.
22975076 2012 ZBRK1 represses HIV-1 LTR-mediated transcription.
21791101 2011 A gene-rich, transcriptionally active environment and the pre-deposition of repressive marks are predictive of susceptibility to KRAB/KAP1-mediated silencing.
20926453 2011 The KRAB-containing zinc-finger transcriptional regulator ZBRK1 activates SCA2 gene transcription through direct interaction with its gene product, ataxin-2.
20713352 2010 RB·E2F1 complex mediates DNA damage responses through transcriptional regulation of ZBRK1.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20306497 2010 Single-nucleotide polymorphisms in the p53 pathway genes modify cancer risk in BRCA1 and BRCA2 carriers of Jewish-Ashkenazi descent.
20221260 2010 KRAB-zinc finger proteins and KAP1 can mediate long-range transcriptional repression through heterochromatin spreading.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20007691 2010 Derepression of HMGA2 via removal of ZBRK1/BRCA1/CtIP complex enhances mammary tumorigenesis.
19996286 2010 ZBRK1 acts as a metastatic suppressor by directly regulating MMP9 in cervical cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19484476 2009 Polymorphisms in BRCA1, BRCA1-interacting genes and susceptibility of breast cancer in Chinese women.
19279087 2009 Regulation of episomal gene expression by KRAB/KAP1-mediated histone modifications.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17764113 2008 Genetic variants and haplotype analyses of the ZBRK1/ZNF350 gene in high-risk non BRCA1/2 French Canadian breast and ovarian cancer families.
17557904 2007 Evaluation of genetic variation in the double-strand break repair pathway and bladder cancer risk.
16997916 2006 KRAB can repress lentivirus proviral transcription independently of integration site.
16485136 2006 Polymorphisms in DNA double-strand break repair genes and risk of breast cancer: two population-based studies in USA and Poland, and meta-analyses.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15596820 2005 The Epstein-Barr virus replication protein BBLF2/3 provides an origin-tethering function through interaction with the zinc finger DNA binding protein ZBRK1 and the KAP-1 corepressor.
15496401 2004 Tetrameric oligomerization mediates transcriptional repression by the BRCA1-dependent Kruppel-associated box-zinc finger protein ZBRK1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15113441 2004 Kin-cohort estimates for familial breast cancer risk in relation to variants in DNA base excision repair, BRCA1 interacting and growth factor genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14755250 2004 An RNF11: Smurf2 complex mediates ubiquitination of the AMSH protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660588 2004 Functional dissection of transcription factor ZBRK1 reveals zinc fingers with dual roles in DNA-binding and BRCA1-dependent transcriptional repression.
14517299 2003 Degradation of transcription repressor ZBRK1 through the ubiquitin-proteasome pathway relieves repression of Gadd45a upon DNA damage.
12872252 2003 Mutational analysis of the BRCA1-interacting genes ZNF350/ZBRK1 and BRIP1/BACH1 among BRCA1 and BRCA2-negative probands from breast-ovarian cancer families and among early-onset breast cancer cases and reference individuals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11161714 2001 Characterization of a novel zinc finger gene with increased expression in nondividing normal human cells.
11090615 2000 Sequence-specific transcriptional corepressor function for BRCA1 through a novel zinc finger protein, ZBRK1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.