Property Summary

NCBI Gene PubMed Count 22
PubMed Score 163.35
PubTator Score 22.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.4e-05
glioblastoma 5572 4.6e-04
medulloblastoma, large-cell 6234 4.8e-04
Disease Target Count Z-score Confidence
Mevalonic aciduria 12 3.578 1.8
Distal arthrogryposis 45 3.369 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.300 4.6e-04
medulloblastoma, large-cell -1.300 4.8e-04
ovarian cancer -1.400 6.4e-05

Gene RIF (2)

PMID Text
21715977 JAZ directly binds E2F1 in vitro in a dsRNA-independent manner, and JAZ's dsRNA binding ZF domains, which are necessary for localizing JAZ to the nucleus, are required for repression of transcriptional activity in vivo.
15254228 JAZ is exported by exportin-5 but translocates back into nuclei by a facilitated diffusion mechanism

AA Sequence

MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF      1 - 70
TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN     71 - 140
MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR    141 - 210
KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM    211 - 280
QRQPIQKDSTTLED                                                            281 - 294
//

Text Mined References (27)

PMID Year Title
25875936 2015 Diagnostic potential of zinc finger protein-specific autoantibodies and associated linear B-cell epitopes in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25331946 2014 JAZ (Znf346), a SIRT1-interacting protein, protects neurons by stimulating p21 (WAF/CIP1) protein expression.
24521053 2014 Structural characterization of interactions between the double-stranded RNA-binding zinc finger protein JAZ and nucleic acids.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21913182 2012 Multicenter study identified molecular blood-born protein signatures for Wilms Tumor.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21715977 2011 JAZ mediates G1 cell cycle arrest by interacting with and inhibiting E2F1.
21269460 2011 Initial characterization of the human central proteome.
19828471 2010 Human IgG antibody profiles differentiate between symptomatic patients with and without colorectal cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15254228 2004 Nucleocytoplasmic shuttling of JAZ, a new cargo protein for exportin-5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10488071 1999 JAZ requires the double-stranded RNA-binding zinc finger motifs for nuclear localization.