Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.40
PubTator Score 1.37

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.2e-03
Disease Target Count Z-score Confidence
Ocular hypertension 27 3.22 1.6


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.024 1.2e-03

AA Sequence

KSLLLVHQRTHSGEKHYVCRECGRGFSHKSNLIRHQRTH                                   561 - 599

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21558551 2011 Genetic loci for blood lipid levels identified by linkage and association analyses in Caribbean Hispanics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.