Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.09
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 4.9e-04
cutaneous lupus erythematosus 1016 8.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 8.0e-03
osteosarcoma -1.279 4.9e-04

Gene RIF (2)

AA Sequence

MLLLLSDQLLLTALRKPNPQAMAALFLSAPPQAEVTFEDVAVYLSREEWGRLGPAQRGLYRDVMLETYGN      1 - 70
LVSLGVGPAGPKPGVISQLERGDEPWVLDVQGTSGKEHLRVNSPALGTRTEYKELTSQETFGEEDPQGSE     71 - 140
PVEACDHISKSEGSLEKLVEQRGPRAVTLTNGESSRESGGNLRLLSRPVPDQRPHKCDICEQSFEQRSYL    141 - 210
NNHKRVHRSKKTNTVRNSGEIFSANLVVKEDQKIPTGKKLHYCSYCGKTFRYSANLVKHQRLHTEEKPYK    211 - 280
CDECGKAFSQSCEFINHRRMHSGEIPYRCDECGKTFTRRPNLMKHQRIHTGEKPYKCGECGKHFSAYSSL    281 - 350
IYHQRIHTGEKPYKCNDCGKAFSDGSILIRHRRTHTGEKPFECKECGKGFTQSSNLIQHQRIHTGEKPYK    351 - 420
CNECEKAFIQKTKLVEHQRSHTGEKPYECNDCGKVFSQSTHLIQHQRIHTGEKPYKCSECGKAFHNSSRL    421 - 490
IHHQRLHHGEKPYRCSDCKKAFSQSTYLIQHRRIHTGEKPYKCSECGKAFRHSSNMCQHQRIHLREDFSM    491 - 560
//

Text Mined References (16)

PMID Year Title