Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.23
PubTator Score 4.89

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.556 1.9e-05
group 4 medulloblastoma 1.200 3.7e-05
medulloblastoma, large-cell 1.300 3.3e-04
ovarian cancer 1.100 1.2e-08

Gene RIF (3)

25505242 The interaction of HIV-1 CA with human cellular zinc finger protein 333 (ZNF333) is identified by yeast two-hybrid screen
15607024 ZNF333 recognized the specific DNA core binding sequence ATAAT
12151103 dna sequence analysis of ZNF333 gene located on chromosome 19p13.1

AA Sequence

SSLTVHKRTHVGRETIRNGSLPLSMSHPYCGPLAN                                       631 - 665

Text Mined References (6)

PMID Year Title
15607024 2004 Identification of the DNA binding element of the human ZNF333 protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12151103 2002 Characterization of ZNF333, a novel double KRAB domain containing zinc finger gene on human chromosome 19p13.1.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.