Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.36
PubTator Score 21.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma -1.300 2.8e-04
osteosarcoma -1.547 2.3e-05
adrenocortical carcinoma -3.649 4.0e-11
tuberculosis -2.200 1.5e-04
non-small cell lung cancer -1.979 2.5e-17
intraductal papillary-mucinous neoplasm ... -2.000 9.3e-03
lung cancer -2.700 4.6e-06
colon cancer -2.200 3.7e-02
ovarian cancer 1.600 3.5e-04
pituitary cancer -1.700 2.0e-04
chronic rhinosinusitis -1.339 1.2e-02

Gene RIF (6)

PMID Text
26134873 the present study provides initial evidence that RITA upregulates the expression level of IRE1a by increasing the stability of IRE1alpha mRNA in irradiated mtp53-expressing cervical cancer cells
25929867 Methylation of ZNF331 Promotes Cell Invasion and Migration in Human Esophageal Cancer
24948044 A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.
22370639 ZNF331 possesses important functions for the suppression of gastric carcinogenesis as a novel functional tumor-suppressor gene
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14610350 Unique expression of a 3.4-kbp transcript of ZNF331 is described in thyroid adenoma cell lines with 19q13 aberrations.

AA Sequence

MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTEKNIHEIRASKR      1 - 70
NSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSFECKDCGKAF     71 - 140
SRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECKDCGKAFRWGSSLVIHKRIHT    141 - 210
GEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAF    211 - 280
ICGSSLIQHKRIHTGEKPYECQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHT    281 - 350
GEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSF    351 - 420
SHGHQLTQHQKTHSGAKSYECKECGKACNHLNHLREHQRIHNS                               421 - 463
//

Text Mined References (19)

PMID Year Title
26134873 2015 RITA enhances irradiation-induced apoptosis in p53-defective cervical cancer cells via upregulation of IRE1?/XBP1 signaling.
25929867 2015 Methylation of ZNF331 Promotes Cell Invasion and Migration in Human Esophageal Cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24948044 2015 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.
22465419 2012 Imprinted gene expression in fetal growth and development.
22370639 2013 Zinc-finger protein 331, a novel putative tumor suppressor, suppresses growth and invasiveness of gastric cancer.
20403199 2010 High-throughput analysis of candidate imprinted genes and allele-specific gene expression in the human term placenta.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19483473 2009 Differential expression of imprinted genes in normal and IUGR human placentas.
19162166 2009 Changes in the peripheral blood transcriptome associated with occupational benzene exposure identified by cross-comparison on two microarray platforms.
17955261 2008 A genome-wide approach to identifying novel-imprinted genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15929907 2005 Discovery of novel biomarkers by microarray analysis of peripheral blood mononuclear cell gene expression in benzene-exposed workers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14610350 2003 A 3.4-kbp transcript of ZNF331 is solely expressed in follicular thyroid adenomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11267678 2001 Isolation, characterization, and mapping of a novel human KRAB zinc finger protein encoding gene ZNF463.
10502321 1999 A KRAB zinc finger protein gene is the potential target of 19q13 translocation in benign thyroid tumors.