Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.29
PubTator Score 1.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.500 7.7e-04
hepatocellular carcinoma 1.100 4.0e-05
osteosarcoma -2.312 1.6e-08
glioblastoma 1.100 5.5e-04
sonic hedgehog group medulloblastoma 2.000 6.8e-05
adrenocortical carcinoma 1.041 1.7e-02
interstitial cystitis -1.700 6.6e-04
atypical teratoid/rhabdoid tumor 1.100 5.7e-03
invasive ductal carcinoma 1.100 3.1e-02
ovarian cancer 1.100 1.2e-02
head and neck cancer -1.100 5.3e-04

AA Sequence

MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIH      1 - 70
TGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQL     71 - 140
ESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHRIIHTGEKPYKCKVCDKAFKHDSHLAKHTRI    141 - 210
HRGDKHYTCNECGKVFDQKATLACHHRSHTGEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGK    211 - 280
TFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRI    281 - 350
HTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDK    351 - 420
VYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSLRSLLAEHQKI    421 - 490
PFGDNCFKCNEYSKPSSIN                                                       491 - 509
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11536051 2001 A novel member of the WD-repeat gene family, WDR11, maps to the 10q26 region and is disrupted by a chromosome translocation in human glioblastoma cells.