Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 8.3e-03
ependymoma 1.600 4.5e-03
oligodendroglioma 1.600 2.4e-03
osteosarcoma 2.191 1.8e-06
atypical teratoid / rhabdoid tumor 1.300 1.0e-03
glioblastoma 1.200 8.8e-03
group 4 medulloblastoma 1.400 3.4e-03
medulloblastoma, large-cell 1.700 2.4e-05
acute myeloid leukemia 1.500 3.5e-02
ovarian cancer -1.400 2.2e-07

Gene RIF (1)

11688974 molecular cloning and characterization of isoforms

AA Sequence

LVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ                                       561 - 595

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11688974 2001 Molecular cloning and characterization of a KRAB-containing zinc finger protein, ZNF317, and its isoforms.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.