Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.32
PubTator Score 2.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 9.5e-09
tuberculosis 2010 2.7e-05
ovarian cancer 8520 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Kaposi's sarcoma 22 3.055 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.200 1.4e-03
psoriasis -1.200 9.5e-09
tuberculosis -1.200 2.7e-05

 GO Component (1)

Gene RIF (2)

AA Sequence

MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALVATLGFWCEAEHEAPSEQSVS      1 - 70
VEGVSQVRTAESGLFQKAHPCEMCDPLLKDILHLAEHQGSHLTQKLCTRGLCRRRFSFSANFYQHQKQHN     71 - 140
GENCFRGDDGGASFVKSCTVHMLGRSFTCREEGMDLPDSSGLFQHQTTYNRVSPCRRTECMESFPHSSSL    141 - 210
RQHQGDYDGQMLFSCGDEGKAFLDTFTLLDSQMTHAEVRPFRCLPCGNVFKEKSALINHRKIHSGEISHV    211 - 280
CKECGKAFIHLHHLKMHQKFHTGKRHYTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGKAYSRSSHL    281 - 350
VQHQRIHTGERPYKCNKCGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHLIEHWRIHTGARPYE    351 - 420
CIECGKFFSHNSSLIKHRRVHTGARSYVCSKCGKAFGCKDTLVQHQIIHTGARPYECSECGKAFSRKDTL    421 - 490
VQHQKIHTGERPYECGECGKFFSHSSNLIVHQRIHTGAKPYECNECGKCFSHNSSLILHQRVHTGARPYV    491 - 560
CSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRNSGLILHQRVHTGEKPYVCSECGKAYSRSSHL    561 - 630
VRHQKAHTGERAHECNSFGGPLAASLKLV                                             631 - 659
//

Text Mined References (6)

PMID Year Title