Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.21
PubTator Score 9.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.400 1.1e-02
adrenocortical carcinoma 1.236 2.3e-03
adult high grade glioma 1.200 1.4e-03
astrocytoma 1.100 1.2e-10
Astrocytoma, Pilocytic 1.300 9.1e-08
atypical teratoid / rhabdoid tumor 1.300 2.1e-02
Breast cancer -1.100 5.9e-04
cystic fibrosis -1.454 2.6e-04
glioblastoma 1.700 1.4e-07
group 3 medulloblastoma 3.400 1.9e-08
medulloblastoma, large-cell 1.800 1.6e-04
oligodendroglioma 1.200 4.2e-02
osteosarcoma 1.881 3.6e-03
primitive neuroectodermal tumor 2.800 1.2e-06

Gene RIF (7)

AA Sequence

MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKLEQGEEPWIIK      1 - 70
GDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLEN     71 - 140
QDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDISIQRFHKYDAFKKNLKPNIDLPSCYKSNSRK    141 - 210
KPDQSFGGGKSSSQSEPNSNLEKIHNGVIPFDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAK    211 - 280
KSQLIVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGE    281 - 350
KPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE    351 - 420
KSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQLIIHQRTHTGE    421 - 490
KPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQ    491 - 560
KSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHTVVKS                              561 - 604
//

Text Mined References (18)

PMID Year Title