Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.13
PubTator Score 2.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 7.3e-11
osteosarcoma 7950 6.5e-07

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 3.800 7.3e-11
osteosarcoma -1.813 6.5e-07

Gene RIF (1)

AA Sequence

MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSSAGRFGGEPHHSP      1 - 70
GPMPAGAALLALGPRNPWTLWTPLTPNYPDRQPWTDKHPDLLTCGRCLQTFPLEAITAFMDHKKLGCQLF     71 - 140
RGPSRGQGSEREELKALSCLRCGKQFTVAWKLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVV    141 - 210
GPAAEAKSPRASGSGLTRRSPTCPVCKKTLSSFSNLKVHMRSHTGERPYACDQCPYACAQSSKLNRHKKT    211 - 280
HRQVPPQSPLMADTSQEQASAAPPEPAVHAAAPTSTLPCSGGEGAGAAATAGVQEPGAPGSGAQAGPGGD    281 - 350
TWGAITTEQRTDPANSQKASPKKMPKSGGKSRGPGGSCEFCGKHFTNSSNLTVHRRSHTGERPYTCEFCN    351 - 420
YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPEAAGEA                   421 - 475
//

Text Mined References (6)

PMID Year Title