Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.68
PubTator Score 7.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma 1524 5.8e-06
glioblastoma 5572 6.7e-05
medulloblastoma, large-cell 6234 2.3e-04
Disease Target Count Z-score Confidence
Adult T-cell leukemia 5 3.156 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 6.7e-05
medulloblastoma 1.200 5.8e-06
medulloblastoma, large-cell 1.100 2.3e-04

Gene RIF (3)

PMID Text
25373738 ZNF282 is E2F1 co-activator involved in esophageal squamous cell carcinoma
22986521 SUMOylation of ZFP282 potentiates its positive effect on estrogen signaling in breast tumorigenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWDMDARRPMPFQ      1 - 70
FPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLLNLEGRTGTAEKKLADCEKTA     71 - 140
VEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWVLRLPPGSKGEAPKVPVTFVDIAVYFSED    141 - 210
EWKNLDEWQKELYNNLVKENYKTLMSLDAEGSVPKPDAPVQAEPREEPCVWEQRHPEEREIPMDPEAGAE    211 - 280
PLVPAQDASSQVKREDTLCVRGQRGLEERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLADRDIP    281 - 350
TDPNSESLISAHDILSWIKQEEQPYPWGPRDSMDGELGLDSGPSDSLLMVKNPPPAPPQPQPQPQPPQPQ    351 - 420
LQSQPQPQSLPPIAVAENPGGPPSRGLLDDGFQVLPGERGSGEAPPGGDRSTGGGGGDGGGGGGGAEAGT    421 - 490
GAGGGCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSHTKERPYECAECEKSFNCHSG    491 - 560
LIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCALCGKSFIRKQNLLKHQRIHTGERPY    561 - 630
TCGECGKSFRYKESLKDHLRVHSGGPGPGAPRQLPPPPERD                                 631 - 671
//

Text Mined References (13)

PMID Year Title
25373738 2014 ZNF282 (Zinc finger protein 282), a novel E2F1 co-activator, promotes esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22986521 2013 SUMOylation of ZFP282 potentiates its positive effect on estrogen signaling in breast tumorigenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
9396811 1997 HUB1, a novel Krüppel type zinc finger protein, represses the human T cell leukemia virus type I long terminal repeat-mediated expression.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.