Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.52
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.600 7.1e-03
atypical teratoid / rhabdoid tumor -1.600 8.4e-04
glioblastoma -1.400 3.4e-03
medulloblastoma, large-cell -1.400 8.8e-05
primitive neuroectodermal tumor 1.200 2.3e-04
acute quadriplegic myopathy 1.013 9.7e-06
primary pancreatic ductal adenocarcinoma 1.567 1.6e-02
adult high grade glioma -1.800 1.5e-04
group 3 medulloblastoma 1.200 2.8e-02
lung adenocarcinoma 1.190 2.1e-03
invasive ductal carcinoma 1.100 2.0e-03
ulcerative colitis 1.500 6.1e-06
ovarian cancer 2.000 3.7e-03
pancreatic cancer 1.200 1.9e-02

 GO Component (2)

Gene RIF (2)

PMID Text
24185900 High ZNF281 expression is associated with colon and breast cancer.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGGGSSGRRAEMEPTFPQGMVMFNHRLPPVTSFTRPAGSA      1 - 70
APPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFLQSLVSIKQEKPADPEEQQS     71 - 140
HHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSSRTDDHHGTE    141 - 210
EPKQDTNVKKAKRPKPESQGIKAKRKPSASSKPSLVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHV    211 - 280
LIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTC    281 - 350
QQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKT    351 - 420
GKTNESQISNNINMQSYSVEMPTVSSSGGIIGTGIDELQKRVPKLIFKKGSRKNTDKNYLNFVSPLPDIV    421 - 490
GQKSLSGKPSGSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKKRRYLPTASSNSAFSINVGHM    491 - 560
VSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSNKSESQKEDPFNIAE    561 - 630
PRVDLHTSGEHSELVQEENLSPGTQTPSNDKASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLH    631 - 700
NHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLID    701 - 770
SQKNLETSSAFQSSSQKLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFK    771 - 840
SGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR                   841 - 895
//

Text Mined References (28)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24185900 2013 SNAIL and miR-34a feed-forward regulation of ZNF281/ZBP99 promotes epithelial-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19147588 2009 Genome-wide promoter analysis of the SOX4 transcriptional network in prostate cancer cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12771217 2003 ZBP-89 represses vimentin gene transcription by interacting with the transcriptional activator, Sp1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10448078 1999 ZBP-99 defines a conserved family of transcription factors and regulates ornithine decarboxylase gene expression.
10405178 1999 Identification of human GC-box-binding zinc finger protein, a new Krüppel-like zinc finger protein, by the yeast one-hybrid screening with a GC-rich target sequence.