Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.437 2.0e-04
astrocytic glioma -1.500 1.4e-02
atypical teratoid / rhabdoid tumor -1.200 4.8e-04
ependymoma -1.200 1.9e-02
glioblastoma -1.700 5.8e-05
lung cancer 1.500 1.8e-03
lung carcinoma 1.400 5.2e-30
malignant mesothelioma 2.700 4.6e-07
medulloblastoma, large-cell -1.700 6.3e-04
non primary Sjogren syndrome sicca -1.200 1.7e-02
non-small cell lung cancer 1.092 1.4e-07
oligodendroglioma -1.200 5.2e-03
osteosarcoma 1.170 4.6e-04
ovarian cancer -2.200 5.6e-07
pediatric high grade glioma -1.100 3.7e-04

Gene RIF (1)

AA Sequence

MEQSCEEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKPVVSNILNRVTPGSWS      1 - 70
RRKKYDHLRKDTARKLQPKSHETVTSEAVTVLPASQLESRSTDSPIIIEPLSKPDYRNSSPQVVPNNSSE     71 - 140
LPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGIIEGNSSASFPSDTFHT    141 - 210
MNTQQSTPSNNVHTSLSHVQNGAPFPAAFPKDNIHFKPINTNLDRENELAKTDILSLTSQNKTFDPKKEN    211 - 280
PIVLLSDFYYGQHKGEGQPEQKTHTTFKCLSCVKVLKNVKFMNHVKHHLEFEKQRNDSWENHTTCQHCHR    281 - 350
QFPTPFQLQCHIENVHTAQEPSTVCKICELSFETDQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVET    351 - 420
HFRTCHENTKNLLCPFCLKIFKTATPYMCHYRGHWGKSAHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPK    421 - 490
QLEGLPPETKVTIQVSLEPLQPGSVDVASITVSTSDSEPSLPRSKSKISKKSH                     491 - 543
//

Text Mined References (11)

PMID Year Title