Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08
PubTator Score 9.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
transitional cell carcinoma 22 3.297 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.900 1.0e-03
group 4 medulloblastoma 1.500 5.3e-04
primitive neuroectodermal tumor 1.200 1.4e-03
psoriasis -1.500 1.5e-05

AA Sequence

MSSAPRGPPSVAPLPAGIGRSTAKTPGLPGSLEMGPLTFRDVAIEFSLEEWQCLDTSQQNLYRNVMLDNY      1 - 70
RNLVFLGIAVSKPDLITCLEQGKEPCNMKRHAMVAKPPVVCSHFAQDLWPKQGLKDSFQKVILRRYGKYG     71 - 140
HENLQLRKGCKSADEHKVHKRGYNGLNQCLTTTQSKIFQCDKYVKVLHKFSNSNIHKKRQTGKKPFKCKE    141 - 210
CGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVNPYKCEECGKAFNQSLTLTKH    211 - 280
KKIHTEEKPYKCEDCGKVFSVFSVLTKHKIIHTGTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCNE    281 - 350
CGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCEECGKAFKRSTTLTKH    351 - 420
KRIYTKEKPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCEECGSAFRAFSTLTEHKRVHTGEKPYKCNE    421 - 490
CGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNRSSNLTRHKKIHTGEKPYKPKRCDSAFDNTPNFSRH    491 - 560
KRNHMGEKS                                                                 561 - 569
//

Text Mined References (8)

PMID Year Title