Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.24
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 5.6e-15
malignant mesothelioma 3163 5.1e-07
osteosarcoma 7933 3.1e-04
lung cancer 4473 3.5e-04

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.900 5.1e-07
osteosarcoma -1.240 3.1e-04
lung cancer 1.400 3.5e-04
psoriasis -1.100 5.6e-15

Gene RIF (1)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular zinc finger protein 26 (ZNF26) is identified by yeast two-hybrid screen

AA Sequence

MATSFRTASCWGLLSFKDISMEFTWDEWQLLDSTQKYLYRDVILENYHNLISVGYHGTKPDLIFKLEQGE      1 - 70
DPWIINAKISRQSCPDGWEEWYQNNQDELESIERSYACSVLGRLNLSKTHDSSRQRLYNTRGKSLTQNSA     71 - 140
PSRSYLRKNPDKFHGYEEPYFLKHQRAHSIEKNCVCSECGKAFRCKSQLIVHLRIHTGERPYECSKCERA    141 - 210
FSAKSNLNAHQRVHTGEKPYSCSECEKVFSFRSQLIVHQEIHTGGKPYGCSECGKAYSWKSQLLLHQRSH    211 - 280
TGVKPYECSECGKAFSLKSPFVVHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKA    281 - 350
FNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTH    351 - 420
TGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKA    421 - 490
FTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK                               491 - 533
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
2026422 1991 Two human genes encoding zinc finger proteins, ZNF 12 (KOX 3) and ZNF 26 (KOX 20), map to chromosome 7p22-p21 and 12q24.33, respectively.