Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.33
PubTator Score 1.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 1.5e-04
osteosarcoma 7766 6.4e-04
group 4 medulloblastoma 1806 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
lung cancer 4607 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.300 1.4e-03
osteosarcoma -1.300 6.4e-04
psoriasis -2.100 1.5e-04

Gene RIF (1)

AA Sequence

MPGPPRSLEMGLLTFRDVAIEFSLEEWQHLDIAQQNLYRNVMLENYRNLAFLGIAVSKPDLITCLEQGKE      1 - 70
PWNMKRHEMVDEPPGMCPHFAQDLWPEQGMEDSFQKAILRRYGKYGHENLQLRKGCKSVDEYKVNKEGYN     71 - 140
GLNQCFTTAQSKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQHKSIYHREKSY    141 - 210
KCKECGKTFNWSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEECGEAFNRSSN    211 - 280
LTTHKIIHTGEKPYKCEECGKAFIWSSTLTEHKKIHTRKKPYKCEECGKAFIWSSTLTRHKRMHTGEKPY    281 - 350
KCEECGKAFSQSSTLTTHKIIHTGEKRYKCLECGKAFKQLSTLTTHKIIHVGEKLYKCEECGKGFNRSSN    351 - 420
LTTHKIIHTGEKPYKCEECGKAFIWSSTLTKHKRIHTREKPYKCEECGKAFIWSSTLTRHKRMHTGEKPY    421 - 490
KCEECGKSFSQSSTLTTHKIIHTGEKPYKCEECGKAFNWSSTLTKHKIIHTEEKPYKCEKCGKAFKQSSI    491 - 560
LTNHKRIHTGEKPYKCEECGKSFNRSSTFTKHKVIHTGVKPYKCEECGKAFFWSSTLTKHKRIHTGEQPY    561 - 630
KWEKFGKAFNRSSHLTTDKITHWREILQV                                             631 - 659
//

Text Mined References (11)

PMID Year Title