Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q0IIN9 Q8NAE8
Symbols C8orf77

 Compartment GO Term (0)

AA Sequence

MLRQSCSFPVTSLPALGGVCGREGAGAEVPPAACGCEGRDPDTERSCGRSSTGGCSPCSGPGPSSPRTSR      1 - 70
GALSPSLGRLFPHLQVVIKLRIQLAPAVHLALPTCSLLTSSPPLEGCCHRLNEEAEVQRGFRPIAVELEF     71 - 140
ENQPLGAETRLRNGRRAGVKRSEGRGQVRPGQVRSTGPEGGLTRMERKAARLQWDSGSIKMSENEQLWEE    141 - 210
P//

Text Mined References (4)

PMID Year Title