Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.29
PubTator Score 0.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.3e-07
tuberculosis 2010 1.5e-04
group 3 medulloblastoma 4104 5.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Leiomyosarcoma 24 3.388 1.7
Gastrointestinal stromal tumor 62 3.063 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 5.0e-04
osteosarcoma -1.541 3.3e-07
tuberculosis -1.300 1.5e-04

AA Sequence

MAAARLLPVPAGPQPLSFQAKLTFEDVAVLLSQDEWDRLCPAQRGLYRNVMMETYGNVVSLGLPGSKPDI      1 - 70
ISQLERGEDPWVLDRKGAKKSQGLWSDYSDNLKYDHTTACTQQDSLSCPWECETKGESQNTDLSPKPLIS     71 - 140
EQTVILGKTPLGRIDQENNETKQSFCLSPNSVDHREVQVLSQSMPLTPHQAVPSGERPYMCVECGKCFGR    141 - 210
SSHLLQHQRIHTGEKPYVCSVCGKAFSQSSVLSKHRRIHTGEKPYECNECGKAFRVSSDLAQHHKIHTGE    211 - 280
KPHECLECRKAFTQLSHLIQHQRIHTGERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCNECGKTFSV    281 - 350
KRTLLQHQRIHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECSECGKTFSHRSTLMNHERIHTEE    351 - 420
KPYACYECGKAFVQHSHLIQHQRVHTGEKPYVCGECGHAFSARRSLIQHERIHTGEKPFQCTECGKAFSL    421 - 490
KATLIVHLRTHTGEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECGECGRAFNQHGHLIQHQKVHRKL    491 - 560
//

Text Mined References (10)

PMID Year Title