Property Summary

NCBI Gene PubMed Count 25
PubMed Score 32.57
PubTator Score 22.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.200 1.3e-02
oligodendroglioma 1.100 5.3e-03
psoriasis -1.800 2.5e-04
osteosarcoma 2.782 7.2e-07
posterior fossa group B ependymoma 1.200 8.9e-07
group 4 medulloblastoma 1.600 3.6e-05
atypical teratoid / rhabdoid tumor 1.400 6.2e-07
glioblastoma 1.300 1.0e-04
medulloblastoma, large-cell 1.800 2.4e-04
spina bifida -1.384 4.1e-02
ovarian cancer 1.400 2.2e-05
dermatomyositis 1.400 4.5e-04

Gene RIF (11)

PMID Text
26317898 miR-940 promoted gastric cancer progression by directly downregulating ZNF24 expression.
25550468 In vivo, knockdown of ZNF24 specifically in microvascular endothelial cells led to significantly decreased formation of functional vascular networks.
24224020 results suggest that consecutive ZF1-2 is critical for the regulation of ZNF24 nuclear localization and its transactivation function.
23212515 ZNF24 represses VEGF transcription through direct binding to an 11-bp fragment of the VEGF proximal promoter and that it functions as a negative regulator of tumor growth by inhibiting angiogenesis.
22678762 ZNF24 may be implicated in transcriptional regulation of genes associated with oncogenesis via interaction with H2A.Z.
22213192 ZNF191 can directly bind to the CTNNB1 promoter and activate the expression of beta-catenin and its downstream target genes such as cyclin D1 in hepatoma cell lines.
20510677 These data suggest that ZNF24 is involved in negative regulation of PDGFR-beta and may represent a novel repressor of PDGFR-beta transcription.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19544452 Data confirm ZNF191 as an essential factor acting for the promotion of the cell cycle and thus maintenance in the progenitor stage.
19463170 ZNF191 is a pleiotropic factor that has a role in hematopoiesis, brain development, and tumor growth.
17270462 Overexpression and purification of single zinc finger peptides of ZNF191 were performed.

AA Sequence

MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGYQDSPGPREAV      1 - 70
SQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENGEEAVTVLEDLESELDDPGQP     71 - 140
VSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSAL    141 - 210
ESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYG    211 - 280
CVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNL    281 - 350
FRHQRRHNAEKLLNVVKV                                                        351 - 368
//

Text Mined References (35)

PMID Year Title
26317898 2015 MicroRNA-940 promotes tumor cell invasion and metastasis by downregulating ZNF24 in gastric cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25550468 2015 The endogenous zinc finger transcription factor, ZNF24, modulates the angiogenic potential of human microvascular endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24224020 2013 Identification of a functional nuclear localization signal mediating nuclear import of the zinc finger transcription factor ZNF24.
23212515 2013 Transcriptional repression of VEGF by ZNF24: mechanistic studies and vascular consequences in vivo.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22678762 2012 A yeast two-hybrid screen identifies histone H2A.Z as a transcription factor ZNF24 interactor.
22213192 2012 Zinc finger transcription factor 191, directly binding to ?-catenin promoter, promotes cell proliferation of hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20510677 2010 The transcriptional repression of platelet-derived growth factor receptor-beta by the zinc finger transcription factor ZNF24.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19544452 2009 Zinc finger protein 191 (ZNF191/Zfp191) is necessary to maintain neural cells as cycling progenitors.
19463170 2009 A transcript profiling approach reveals the zinc finger transcription factor ZNF191 is a pleiotropic factor.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17270462 2007 Overexpression and purification of single zinc finger peptides of human zinc finger protein ZNF191.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10585455 1999 Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB.
10567577 1999 The zinc finger-associated SCAN box is a conserved oligomerization domain.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
2004757 1991 Chromosomal localization of two human zinc finger protein genes, ZNF24 (KOX17) and ZNF29 (KOX26), to 18q12 and 17p13-p12, respectively.