Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.77
PubTator Score 6.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.8e-08
lung cancer 4473 5.8e-06
invasive ductal carcinoma 2950 7.4e-03
colon cancer 1475 4.6e-02
Disease Target Count Z-score Confidence
Rabies 19 3.682 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 4.600 2.8e-08
lung cancer 4.400 5.8e-06
colon cancer 1.900 4.6e-02
invasive ductal carcinoma 1.300 7.4e-03

Gene RIF (7)

PMID Text
20641033 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19490114 Data identified Ser38 and Ser129 of hsMOK2 as phosphorylation sites of JNK3 kinase, and Ser46 as a phosphorylation site of Aurora A and protein kinase A.
17760566 Results indicate that pathogenic mutations in lamin A/C lead to sequestration of hsMOK2 into nuclear aggregates, which may deregulate MOK2 target genes.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12409453 In this study, we identify a novel interaction between lamin A/C and hsMOK2 by using the yeast two-hybrid system

AA Sequence

MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSS      1 - 70
QIDTQDSSVKFCKNEPQDHQESRRLFVMEESTERKVIKGESCSENLQVKLVSDGQELASPLLNGEATCQN     71 - 140
GQLKESLDPIDCNCKDIHGWKSQVVSCSQQRAHTEEKPCDHNNCGKILNTSPDGHPYEKIHTAEKQYECS    141 - 210
QCGKNFSQSSELLLHQRDHTEEKPYKCEQCGKGFTRSSSLLIHQAVHTDEKPYKCDKCGKGFTRSSSLLI    211 - 280
HHAVHTGEKPYKCDKCGKGFSQSSKLHIHQRVHTGEKPYECEECGMSFSQRSNLHIHQRVHTGERPYKCG    281 - 350
ECGKGFSQSSNLHIHRCIHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLI    351 - 420
HQRVHTGEKPYECSKCGKGFSQSSNLHIHQRVHKKDPR                                    421 - 458
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20641033 2011 Polymorphisms in predicted miRNA binding sites and osteoporosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19490114 2009 Phosphorylation-dependent binding of human transcription factor MOK2 to lamin A/C.
17760566 2008 Mislocalization of human transcription factor MOK2 in the presence of pathogenic mutations of lamin A/C.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12409453 2002 In vivo and in vitro interaction between human transcription factor MOK2 and nuclear lamin A/C.
9121460 1997 Human and mouse MOK2 proteins are associated with nuclear ribonucleoprotein components and bind specifically to RNA and DNA through their zinc finger domains.
8903737 1996 Localization of zinc finger Mok2 gene to mouse chromosome 6, a new region of homology with human chromosome 19.
8587123 1995 Human and mouse Krüppel-like (MOK2) orthologue genes encode two different zinc finger proteins.