Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.15
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.900 8.4e-07
breast carcinoma -1.300 1.4e-05
glioblastoma 1.100 2.2e-03
group 3 medulloblastoma 1.500 6.8e-04
lung adenocarcinoma -1.300 5.5e-06
malignant mesothelioma 1.700 2.6e-07
medulloblastoma, large-cell 1.200 3.6e-04
ovarian cancer 1.100 3.6e-09

Gene RIF (2)

AA Sequence

MEGSRPRAPSGHLAPSPPAFDGELDLQRYSNGPAVSAGSLGMGAVSWSESRAGERRFPCPVCGKRFRFNS      1 - 70
ILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLLLELEERALLREARLGRARSS     71 - 140
GGMQATPATEGLARPQAPSSSAFRCPYCKGKFRTSAERERHLHILHRPWKCGLCSFGSSQEEELLHHSLT    141 - 210
AHGAPERPLAATSAAPPPQPQPQPPPQPEPRSVPQPEPEPEPEREATPTPAPAAPEEPPAPPEFRCQVCG    211 - 280
QSFTQSWFLKGHMRKHKASFDHACPVCGRCFKEPWFLKNHMKVHASKLGPLRAPGPASGPARAPQPPDLG    281 - 350
LLAYEPLGPALLLAPAPTPAERREPPSLLGYLSLRAGEGRPNGEGAEPGPGRSFGGFRPLSSALPARARR    351 - 420
HRAEEPEEEEEVVEAEEETWARGRSLGSLASLHPRPGEGPGHSASAAGAQARSTATQEENGLLVGGTRPE    421 - 490
GGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGSLKYHLQRHHREQRSGAGPGP    491 - 560
PPEPPPPSQRGSAPQSGAKPSPQPATWVEGASSPRPPSSGAGPGSRRKPASPGRTLRNGRGGEAEPLDLS    561 - 630
LRAGPGGEAGPGGALHRCLFCPFATGAPELMALHLQVHHSRRARGRRPPQADASPPYARVPSGETPPSPS    631 - 700
QEGEEGSGLSRPGEAGLGGQER                                                    701 - 722
//

Text Mined References (15)

PMID Year Title