Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.15
PubTator Score 7.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 2.4e-02
interstitial cystitis 1.200 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 7.8e-03
periodontitis 1.300 9.7e-24

AA Sequence

MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQKFRHFQYLKVSGPHEALSQLW      1 - 70
ELCLQWLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMVTLIEDVIEMLEDEDMPCKDS     71 - 140
ALQMGSIKEKMKAGSRTGKPQEPVTFKDVVVEFSKEEWGQLDSAVKNLYRNVMLENFRNLNSLRKAHLLS    141 - 210
KPFESLKLESKKKRWIMEKEIPRKTIFDMKSISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKW    211 - 280
DINLPQEAFIPETIYTEEEDFECSENKKSFDINSVSSICAIQVGIPSRKGSPKCDKFKTYFKFNLDSVGK    281 - 350
QHSEYEYGNDLSLSTDIRHQKSHTTMNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRT    351 - 420
NLTKHQKLHAEAKACTSNKCGKAFSKSEDSNNPTLHFGNNFYQCVNCGKSFNRSSSLIRHQMIHTGEKPF    421 - 490
KCKECSKAFNRSSNLVKHQKLHTRDKS                                               491 - 517
//

Text Mined References (10)

PMID Year Title