Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.93
PubTator Score 7.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute quadriplegic myopathy 1.327 1.2e-05
astrocytic glioma 2.400 3.2e-03
ependymoma 2.600 1.2e-03
gastric cancer 1.900 6.6e-04
glioblastoma 1.800 2.8e-03
group 3 medulloblastoma 1.500 3.9e-02
hepatocellular carcinoma 1.600 5.4e-06
intraductal papillary-mucinous adenoma (... 1.800 9.7e-04
intraductal papillary-mucinous carcinoma... 1.300 4.5e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.4e-02
juvenile dermatomyositis 1.058 1.6e-07
lung cancer 1.100 2.9e-03
medulloblastoma, large-cell 1.400 4.4e-03
Multiple myeloma 1.653 1.1e-04
non primary Sjogren syndrome sicca -1.100 1.3e-02
oligodendroglioma 2.600 1.4e-03
osteosarcoma 1.369 7.8e-05
ovarian cancer -1.500 5.8e-07
pancreatic cancer 1.200 6.5e-03
pancreatic carcinoma 1.200 6.5e-03
pancreatic ductal adenocarcinoma liver m... 1.516 2.7e-02
Pick disease -2.500 6.5e-07
pituitary cancer -1.200 1.7e-03
primitive neuroectodermal tumor 1.100 7.1e-03
progressive supranuclear palsy -2.000 5.6e-03
psoriasis 1.100 9.0e-04
sarcoidosis 1.100 1.7e-02
Waldenstrons macroglobulinemia 1.206 1.2e-02

Gene RIF (1)

AA Sequence

MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIP      1 - 70
GRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIP     71 - 140
PMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGMMPMGGMMPPGPGIPPLMPGMPPGMP    141 - 210
PPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSA    211 - 280
SSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSK    281 - 350
PATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRP    351 - 420
PMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY                421 - 478
//

Text Mined References (13)

PMID Year Title