Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.86
PubTator Score 17.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.5e-07
group 3 medulloblastoma 2254 1.1e-05
osteosarcoma 7933 5.6e-05
psoriasis 6685 1.2e-04
lung cancer 4473 4.5e-04
Disease Target Count Z-score Confidence
Pelizaeus-Merzbacher disease 20 3.147 1.6
Colon adenoma 5 3.124 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.700 2.5e-07
psoriasis -1.600 1.2e-04
osteosarcoma -1.431 5.6e-05
lung cancer 1.700 4.5e-04
group 3 medulloblastoma 1.300 1.1e-05

Gene RIF (12)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human zinc finger protein 202 (ZNF202) at amino acid residues 68-69 by the HIV-1 protease
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875103 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
18652945 Homozygosity for a common functional promoter variant in ZNF202 predicts severe atherosclerosis and an increased risk of IHD.
18523156 SOX17-Chromatin immunoprecipitation identified zinc finger protein 202 (Zfp202) as a direct target of SOX17 during endoderm differentiation of F9 embryonal carcinoma cells.
16467280 Observational study of gene-disease association. (HuGE Navigator)
16467280 findings show that genetic variation in ZNF202 is common in the general population. However, SNPs in the protein-coding region of ZNF202 do not make a major contribution to HDL cholesterol levels.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16289551 Observational study of gene-disease association. (HuGE Navigator)
16289551 This is the first study to suggest that ZNF202 could be a new candidate gene for ischemic heart disease and myocardial infarction in the general population.

AA Sequence

MATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASPREALIRLREL      1 - 70
CHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRRWVTVHVH     71 - 140
GQEVLSEETVHLGVEPESPNELQDPVQSSTPEQSPEETTQSPDLGAPAEQRPHQEEELQTLQESEVPVPE    141 - 210
DPDLPAERSSGDSEMVALLTALSQGLVTFKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFP    211 - 280
IPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQ    281 - 350
TPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHLRTHT    351 - 420
GEKPYKCMECGKSYTRSSHLARHQKVHKMNAPYKYPLNRKNLEETSPVTQAERTPSVEKPYRCDDCGKHF    421 - 490
RWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCGECGEDFSEHRRYLAHRKTHA    491 - 560
AEELYLCSECGRCFTHSAAFAKHLRGHASVRPCRCNECGKSFSRRDHLVRHQRTHTGEKPFTCPTCGKSF    561 - 630
SRGYHLIRHQRTHSEKTS                                                        631 - 648
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875103 2010 Genomewide association study of movement-related adverse antipsychotic effects.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
18652945 2008 Functional promoter variant in zinc finger protein 202 predicts severe atherosclerosis and ischemic heart disease.
18523156 2008 SOX17 directly activates Zfp202 transcription during in vitro endoderm differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16467280 2006 Zinc Finger Protein 202, genetic variation, and HDL cholesterol in the general population.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
16289551 2006 Zinc Finger Protein 202: a new candidate gene for ischemic heart disease: The Copenhagen City Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444922 2003 SDP1 is a peroxisome-proliferator-activated receptor gamma 2 co-activator that binds through its SCAN domain.
11279031 2001 The zinc finger protein 202 (ZNF202) is a transcriptional repressor of ATP binding cassette transporter A1 (ABCA1) and ABCG1 gene expression and a modulator of cellular lipid efflux.
10748193 2000 A broad role for the zinc finger protein ZNF202 in human lipid metabolism.
10747874 2000 The SCAN domain mediates selective oligomerization.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9790754 1998 Molecular cloning and characterization of ZNF202: a new gene at 11q23.3 encoding testis-specific zinc finger proteins.