Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.46
PubTator Score 0.78

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 7.0e-03
ependymoma 1.900 2.1e-03
oligodendroglioma 1.300 3.4e-03
group 4 medulloblastoma 1.500 7.2e-07
medulloblastoma, large-cell 1.100 4.7e-04

AA Sequence

AFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW                                    421 - 458

Text Mined References (12)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.