Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.98
PubTator Score 52.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.100 3.8e-03
malignant mesothelioma 1.600 3.1e-07
esophageal adenocarcinoma -3.200 2.2e-02
osteosarcoma -2.042 1.4e-03
ependymoma 1.600 2.6e-04
atypical teratoid / rhabdoid tumor 1.100 2.0e-02
adrenocortical carcinoma -1.846 2.6e-03
tuberculosis 1.100 7.1e-04
intraductal papillary-mucinous adenoma (... 2.300 4.8e-02
lung cancer -2.700 1.2e-05
interstitial cystitis -1.600 1.3e-04
pancreatic carcinoma 1.100 3.8e-03
nasopharyngeal carcinoma -1.500 8.5e-06
lung carcinoma -1.100 1.8e-26
spina bifida -1.914 4.0e-02

Gene RIF (3)

PMID Text
16799630 ZNF185 may function as a tumor-suppressor protein by associating with the actin-cytoskeleton
15731117 transcriptional activation of ZNF185 and CYP3A4 is mediated by direct association of BRG1 with their promoters and a decreased level of ZNF185 is a common feature of lung tumours
12873976 Transcriptional silencing of ZNF185 by methylation in prostate tumor tissues implicates the ZNF185 gene in prostate tumorigenesis.

AA Sequence

MSISALGGRTKGKPLPPGEEERNNVLKQMKVRTTLKGDKSWITKQDESEGRTIELPSGRSRATSFSSAGE      1 - 70
VPKPRPPSTRAPTGYIIRGVFTKPIDSSSQPQQQFPKANGTPKSAASLVRTANAGPPRPSSSGYKMTTED     71 - 140
YKKLAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREHSYVLSAAKKSTGPTQET    141 - 210
QAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGE    211 - 280
EIVRLQILTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNV    281 - 350
GSGATGSRPEGLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKADPKGALADYEGKDVATRVGEA    351 - 420
WQERPGAPRGGQGDPAVPAQQPADPSTPERQSSPSGSEQLVRRESCGSSVLTDFEGKDVATKVGEAWQDR    421 - 490
PGAPRGGQGDPAVPTQQPADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIYIP    491 - 560
APASELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGSTPYSERTTGGICT    561 - 630
YCNREIRDCPKITLEHLGICCHEYCFKCGICSKPMGDLLDQIFIHRDTIHCGKCYEKLF               631 - 689
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16799630 2007 ZNF185, an actin-cytoskeleton-associated growth inhibitory LIM protein in prostate cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15731117 2005 Transcriptional targets of the chromatin-remodelling factor SMARCA4/BRG1 in lung cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12873976 2003 Transcriptional silencing of zinc finger protein 185 identified by expression profiling is associated with prostate cancer progression.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
9268636 1997 Genomic structure of a novel LIM domain gene (ZNF185) in Xq28 and comparisons with the orthologous murine transcript.