Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.33
PubTator Score 5.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.176 1.1e-02
astrocytic glioma 2.100 4.1e-03
ependymoma 1.400 2.1e-02
group 4 medulloblastoma 1.100 1.2e-03
intraductal papillary-mucinous adenoma (... 1.500 1.5e-03
intraductal papillary-mucinous carcinoma... 1.100 3.5e-02
Multiple myeloma -2.044 5.0e-03
oligodendroglioma 2.200 9.4e-04
osteosarcoma 1.876 2.7e-05
ovarian cancer -1.200 9.1e-03
pancreatic ductal adenocarcinoma liver m... 2.748 2.6e-03
Pick disease 1.500 4.6e-07
psoriasis -1.400 3.7e-10

Gene RIF (1)

AA Sequence

MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVK      1 - 70
SCVKIARKPRTPECVKGVVTDIPPKCTIKDLLPKEKSSTEAVFHTVVLERHESPDIEDFSFKEPQKNVHD     71 - 140
FECQWRDDTGNYKGVLMAQKEGKRDQRDRRDIENKLMNNQLGVSFHSHLPELQLFQGEGKMYECNQVEKS    141 - 210
TNNGSSVSPLQQIPSSVQTHRSKKYHELNHFSLLTQRRKANSCGKPYKCNECGKAFTQNSNLTSHRRIHS    211 - 280
GEKPYKCSECGKTFTVRSNLTIHQVIHTGEKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNECGKAF    281 - 350
RGHSNLTTHQLIHTGEKPFKCNECGKLFTQNSHLISHWRIHTGEKPYKCNECGKAFSVRSSLAIHQTIHT    351 - 420
GEKPYKCNECGKVFRYNSYLGRHRRVHTGEKPYKCNECGKAFSMHSNLATHQVIHTGTKPFKCNECSKVF    421 - 490
TQNSQLANHRRIHTGEKPYKCNECGKAFSVRSSLTTHQAIHSGEKPYKCIECGKSFTQKSHLRSHRGIHS    491 - 560
GEKPYKCNECGKVFAQTSQLARHWRVHTGEKPYKCNDCGRAFSDRSSLTFHQAIHTGEKPYKCHECGKVF    561 - 630
RHNSYLATHRRIHTGEKPYKCNECGKAFSMHSNLTTHKVIHTGEKPYKCNQCGKVFTQNSHLANHQRTHT    631 - 700
GEKPYRCNECGKAFSVRSSLTTHQAIHTGKKPYKCNECGKVFTQNAHLANHRRIHTGEKPYRCTECGKAF    701 - 770
RVRSSLTTHMAIHTGEKRYKCNECGKVFRQSSNLASHHRMHTGEKPYK                          771 - 818
//

Text Mined References (11)

PMID Year Title