Property Summary

NCBI Gene PubMed Count 54
PubMed Score 65.37
PubTator Score 49.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia 1.500 2.1e-02
adult high grade glioma -1.300 2.8e-04
atypical teratoid / rhabdoid tumor -1.100 5.1e-03
Crohn's disease -1.132 8.2e-04
gastric cancer 1.100 8.8e-04
glioblastoma -1.100 1.9e-07
group 4 medulloblastoma 1.200 1.8e-04
medulloblastoma, large-cell -1.100 1.1e-02
osteosarcoma 2.398 4.3e-08
ovarian cancer -1.100 3.7e-04
pancreatic ductal adenocarcinoma liver m... 1.358 1.0e-02
Pick disease 1.600 9.9e-09
psoriasis 1.800 2.1e-05
Rheumatoid arthritis 2.500 4.6e-03
ulcerative colitis -1.373 4.5e-04

Protein-protein Interaction (3)

Gene RIF (31)

AA Sequence

MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAADEVLQESEMR      1 - 70
QQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITFTDVSEQLMRDKKQIREPVDL     71 - 140
QKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQ    141 - 210
KYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHEN    211 - 280
HDKKLNRCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYS    281 - 350
SSTKVKDEYMVAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES    351 - 420
KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAASNNSREYALN    421 - 490
VGTIASQPSVTQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEVLQTLLDHYSHKANGQHEISF    491 - 560
SVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKANMLQEYSKFLQQALDRTSQNDAYLNSPSLNF    561 - 630
VTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASAT    631 - 700
STQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFP    701 - 770
LVNVNDNRAGMTSSPDATTGQTFG                                                  771 - 794
//

Text Mined References (68)

PMID Year Title