Property Summary

NCBI Gene PubMed Count 49
PubMed Score 60.68
PubTator Score 49.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.500 4.6e-03
gastric cancer 1.100 8.8e-04
psoriasis 1.800 2.1e-05
osteosarcoma 3.503 5.7e-10
glioblastoma -1.800 7.8e-07
atypical teratoid / rhabdoid tumor -2.000 1.6e-05
medulloblastoma, large-cell -1.600 1.1e-05
Crohn's disease -1.132 8.2e-04
ulcerative colitis -1.373 4.5e-04
pancreatic ductal adenocarcinoma liver m... 1.358 1.0e-02
pediatric high grade glioma -1.400 7.5e-06
group 4 medulloblastoma 1.200 1.8e-04
acute myeloid leukemia 1.500 2.1e-02
Pick disease 1.600 9.9e-09
ovarian cancer -1.300 4.9e-06

Pathway (1)

Gene RIF (30)

PMID Text
26891870 A larger role ZBP-89 plays in gene regulation during inflammation.ZBP-89 regulates of MMP-1 expression.ZBP-89 and NF-kappaB appear to bind cooperatively on both promoters.
25623232 ZBP-89 attenuates HDAC3 by increasing IkappaB degradation, dependent on Pin1 but independent of NF-Kappab
23954442 zinc-binding protein-89 upregulates the expression of Bak by targeting multiple components of the epigenetic pathway in hepatocellular carcinoma.
23576061 lower expression of ZNF148 in colorectal cancer was significantly associated with worse clinicopathologic variables, including lymph node metastases, poor differentiation, and a higher rate of disease recurrence
22982674 this study provides vigorous evidence that ZBP-89 was significantly downregulated in clear cell renal cell carcinoma(CCRCC) and could be served as a promising biomarker for prediction of distal metastasis and prognosis of patient with CCRCC.
22372401 Colony formation was reduced dramatically in those hepatocellular carcinoma cell lines in which ZBP-89 overexpression was demonstrated; this appeared to correlate with increased apoptosis.
22214764 We found that the TP53-G245D variant but not TP53-R249S abrogated HDAC inhibitor p21 induction by binding to ZBP-89 and retaining it in the cytoplasm.
22111549 ZBP-89 is a regulator of Pdcd4 gene, binding to the basal promoter either alone or by interacting with Sp family members.
21828133 An activating role for ZBP-89 in human globin gene regulation and erythroid differentiation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19875459 Alternative binding of ZBP89 or SP1 to the described region in the IRS2 promoter regulates neuronal IRS2 expression in a PI3K-dependent manner.
19583777 ZBP-89 iss able to restrain senescence in NCI-H460 human lung cancer cells, through epigenetically regulating p(16INK4a) expression.
19362768 ZBP-89 greatly enhanced the killing effectiveness of 5-fluorouracil or staurosporine in hepatocellular carcinoma cells.
19275880 both NF-kappaB and ZBP-89 bind to the site in vivo and provide evidence of competitive binding to MMP-3 promoter.
18854154 Knockdown of zinc finger protein 148 (ZNF148) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18496767 Transcription factors Sp3, ZBP-89 and NF-Y are capable of binding to the SOX18 promoter region.
18250154 ZBP-89 plays a role in erythroid and megakaryocytic development by cooperating with GATA-1 and/or FOG-1 in a developmental stage-specific manner.
17940278 sumoylation provides a reversible post-translational mechanism to control the activity of ZBP-89.
17663720 ZBP-89 functions as a repressor by recruiting HDAC1 to the vimentin promoter.
17560543 ataxia telangiectasia mutated protein phosphorylation of ZBP-89 contributes to Histone deacetylase inhibitors induction of p21(waf1) gene expression
17019648 Enhanced ZNF148 expression activates intestinal apoptosis, therefore ZNF148 is a therapeutic target to inhibit colon cancer development.
16827139 ZBP-89 is an important co-activator of wild-type p53 and both proteins are negatively affected by functionally inactive p53 mutants.
16825291 Ectopic expression of ZBP-89 amplified the inhibitory effect of Fatty Acids on L2 -GH promoter activity.
16384873 We conclude that ZBP-89 is a direct transcriptional activator of the enterocyte differentiation marker IAP.
15175029 Observational study of gene-disease association. (HuGE Navigator)
15175029 No association with psoriasis susceptibility
14963412 ZBP-89-mediated apoptosis occurs via a p53-independent mechanism that requires JNK activation.
14712222 interaction of Stat3 and ZBP-89 may be crucial for overcoming the effects of the repressor ZBP-89, which suggests a novel mode for Stat3 gene activation.
12759240 ZBP-89 co-localized with p53 in the nucleus in about 67% (12 of 18) of all cases positive for the nuclear p53 protein, suggesting that ZBP-89 may play a role in the nuclear accumulation of the p53 protein in a subset recurrent hepatocellular carcinoma.
12393719 ZBP-89 is a repressor of the human beta 2-integrin CD11b gene during differentiation of monocytes into macrophages

AA Sequence

MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAADEVLQESEMR      1 - 70
QQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITFTDVSEQLMRDKKQIREPVDL     71 - 140
QKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQ    141 - 210
KYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHEN    211 - 280
HDKKLNRCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYS    281 - 350
SSTKVKDEYMVAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES    351 - 420
KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAASNNSREYALN    421 - 490
VGTIASQPSVTQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEVLQTLLDHYSHKANGQHEISF    491 - 560
SVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKANMLQEYSKFLQQALDRTSQNDAYLNSPSLNF    561 - 630
VTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASAT    631 - 700
STQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFP    701 - 770
LVNVNDNRAGMTSSPDATTGQTFG                                                  771 - 794
//

Text Mined References (62)

PMID Year Title
26891870 2016 Zinc-binding protein-89 (ZBP-89) cooperates with NF-?B to regulate expression of matrix metalloproteinases (MMPs) in response to inflammatory cytokines.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25623232 2015 ZBP-89 reduces histone deacetylase 3 by degrading IkappaB in the presence of Pin1.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23954442 2013 Epigenetic upregulation of Bak by ZBP-89 inhibits the growth of hepatocellular carcinoma.
23576061 2013 Expression of ZNF148 in different developing stages of colorectal cancer and its prognostic value: a large Chinese study based on tissue microarray.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22982674 2012 High-expression of ZBP-89 correlates with distal metastasis and poor prognosis of patients in clear cell renal cell carcinoma.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22372401 2012 Increased expression of ZBP-89 and its prognostic significance in hepatocellular carcinoma.
22214764 2012 Interaction between ZBP-89 and p53 mutants and its contribution to effects of HDACi on hepatocellular carcinoma.
22111549 2012 Promoter cloning and characterization of the human programmed cell death protein 4 (pdcd4) gene: evidence for ZBP-89 and Sp-binding motifs as essential Pdcd4 regulators.
21828133 2011 Role of ZBP-89 in human globin gene regulation and erythroid differentiation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19875459 2010 Neuronal insulin receptor substrate 2 (IRS2) expression is regulated by ZBP89 and SP1 binding to the IRS2 promoter.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19583777 2009 The transcription factor ZBP-89 suppresses p16 expression through a histone modification mechanism to affect cell senescence.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19362768 2009 ZBP-89 reduces the cell death threshold in hepatocellular carcinoma cells by increasing caspase-6 and S phase cell cycle arrest.
19275880 2009 NF-kappaB and ZBP-89 regulate MMP-3 expression via a polymorphic site in the promoter.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18496767 2009 ZBP-89 and Sp3 down-regulate while NF-Y up-regulates SOX18 promoter activity in HeLa cells.
18250154 2008 Identification of ZBP-89 as a novel GATA-1-associated transcription factor involved in megakaryocytic and erythroid development.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17940278 2007 Sumoylation-dependent control of homotypic and heterotypic synergy by the Kruppel-type zinc finger protein ZBP-89.
17663720 2007 The zinc finger repressor, ZBP-89, recruits histone deacetylase 1 to repress vimentin gene expression.
17560543 2007 ATM phosphorylates ZBP-89 at Ser202 to potentiate p21waf1 induction by butyrate.
17019648 2006 Intestinal overexpression of ZNF148 suppresses ApcMin/+ neoplasia.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16827139 P53 mutants suppress ZBP-89 function.
16825291 2006 Inhibition of growth hormone receptor gene expression by saturated fatty acids: role of Kruppel-like zinc finger factor, ZBP-89.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16517939 2006 An isoform of ZBP-89 predisposes the colon to colitis.
16384873 2006 Intestinal alkaline phosphatase gene expression is activated by ZBP-89.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15190078 2004 Regulation of murine cytochrome c oxidase Vb gene expression during myogenesis: YY-1 and heterogeneous nuclear ribonucleoprotein D-like protein (JKTBP1) reciprocally regulate transcription activity by physical interaction with the BERF-1/ZBP-89 factor.
15175029 2004 Association analysis of cystatin A and zinc finger protein 148, two genes located at the psoriasis susceptibility locus PSORS5.
14963412 2004 ZBP-89-induced apoptosis is p53-independent and requires JNK.
14712222 2004 Stat3 enhances vimentin gene expression by binding to the antisilencer element and interacting with the repressor protein, ZBP-89.
12771217 2003 ZBP-89 represses vimentin gene transcription by interacting with the transcriptional activator, Sp1.
12759240 2003 Mutation of p53 in recurrent hepatocellular carcinoma and its association with the expression of ZBP-89.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393719 2003 The zinc finger transcription factor ZBP-89 is a repressor of the human beta 2-integrin CD11b gene.
11416144 2001 ZBP-89 promotes growth arrest through stabilization of p53.
10899165 2000 Transcription factor ZBP-89 cooperates with histone acetyltransferase p300 during butyrate activation of p21waf1 transcription in human cells.
10727401 2000 PTRF (polymerase I and transcript-release factor) is tissue-specific and interacts with the BFCOL1 (binding factor of a type-I collagen promoter) zinc-finger transcription factor which binds to the two mouse type-I collagen gene promoters.
10359087 1999 Human stromelysin gene promoter activity is modulated by transcription factor ZBP-89.
9925940 1998 The gene encoding the transcriptional repressor BERF-1 maps to a region of conserved synteny on mouse chromosome 16 and human chromosome 3 and a related pseudogene maps to mouse chromosome 8.
9685330 1998 Transcription factor ZBP-89 regulates the activity of the ornithine decarboxylase promoter.
9457682 1998 The human ZBP-89 homolog, located at chromosome 3q21, represses gastrin gene expression.
9144414 1997 Overexpression of ZBP-89, a zinc finger DNA binding protein, in gastric cancer.
8943318 1996 ZBP-89, a Krüppel-like zinc finger protein, inhibits epidermal growth factor induction of the gastrin promoter.
8355710 1993 The ht beta gene encodes a novel CACCC box-binding protein that regulates T-cell receptor gene expression.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.