Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.59
PubTator Score 14.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.674 6.7e-05
Multiple myeloma 1.214 4.7e-03
osteosarcoma 2.750 3.3e-05
medulloblastoma 1.700 8.1e-07
atypical teratoid/rhabdoid tumor 1.300 5.4e-04
medulloblastoma, large-cell 1.900 1.1e-06
primitive neuroectodermal tumor 1.200 4.4e-04
adrenocortical carcinoma 1.021 3.5e-02
non-small cell lung cancer 1.294 1.0e-12
lung cancer 1.100 1.3e-03
diabetes mellitus -1.500 1.9e-03
Pick disease -1.500 3.0e-04
progressive supranuclear palsy -1.800 4.2e-03
invasive ductal carcinoma 1.200 1.6e-02
acute myeloid leukemia -1.200 1.3e-02
ovarian cancer 1.900 6.0e-04

Gene RIF (2)

PMID Text
15881673 OZF interacts with UBC9, the E2 enzyme involved in the covalent conjugation of the small ubiquitin-like modifier 1 (SUMO-1).
15838871 OZF overexpression in tumours may alter the balance between hRap1 and other telomeric proteins; therefore OZF function may be linked to telomere regulation

AA Sequence

MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEK      1 - 70
LFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGK     71 - 140
SNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDK    141 - 210
PYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQK    211 - 280
SHHIRHQKIHTH                                                              281 - 292
//

Text Mined References (15)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15881673 2005 A Kruppel zinc finger of ZNF 146 interacts with the SUMO-1 conjugating enzyme UBC9 and is sumoylated in vivo.
15838871 2005 Zinc finger protein overexpressed in colon carcinoma interacts with the telomeric protein hRap1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12754738 2003 The zinc finger protein OZF (ZNF146) is overexpressed in colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306801 2001 Genomic organization and promoter identification of ZNF146, a gene encoding a protein consisting solely of zinc finger domains.
10449921 1999 Cloning, characterization, and chromosome assignment of Zfp146 the mouse ortholog of human ZNF146, a gene amplified and overexpressed in pancreatic cancer, and Zfp260 a closely related gene.
9935176 1999 Amplification and over-expression of OZF, a gene encoding a zinc finger protein, in human pancreatic carcinomas.
8665923 1996 Identification, nuclear localization, and binding activities of OZF, a human protein solely composed of zinc-finger motifs.
8641144 1996 Localization of ZNF164, ZNF146, GGTA1, SOX2, PRLR and EEF2 on homoeologous cattle, sheep and goat chromosomes by fluorescent in situ hybridization and comparison with the human gene map.
8107129 1994 The OZF gene encodes a protein consisting essentially of zinc finger motifs.