Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.92
PubTator Score 14.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.200 1.3e-02
adrenocortical carcinoma 1.021 3.5e-02
atypical teratoid / rhabdoid tumor 1.200 2.6e-05
diabetes mellitus -1.500 1.9e-03
group 3 medulloblastoma 1.600 1.9e-02
invasive ductal carcinoma 1.200 1.6e-02
lung cancer 1.100 1.3e-03
medulloblastoma, large-cell 1.900 1.1e-06
Multiple myeloma 1.214 4.7e-03
non-small cell lung cancer 1.294 1.0e-12
osteosarcoma 2.750 3.3e-05
ovarian cancer 1.900 6.0e-04
Pick disease -1.500 3.0e-04
primitive neuroectodermal tumor 1.200 4.4e-04
progressive supranuclear palsy -1.800 4.2e-03
Waldenstrons macroglobulinemia 1.674 6.7e-05

Gene RIF (2)

AA Sequence

MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEK      1 - 70
LFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGK     71 - 140
SNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDK    141 - 210
PYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQK    211 - 280
SHHIRHQKIHTH                                                              281 - 292
//

Text Mined References (16)

PMID Year Title