Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.97
PubTator Score 0.73

Knowledge Summary


No data available



  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.200 3.0e-03
hepatocellular carcinoma 1.400 9.7e-06
pancreatic cancer 1.100 4.8e-03
psoriasis -2.000 5.4e-04
medulloblastoma 1.400 7.8e-07
tuberculosis and treatment for 6 months -2.000 3.6e-05
pancreatic carcinoma 1.100 4.8e-03
ovarian cancer -1.200 1.8e-05

AA Sequence

SFSWSSNLAKHQRTHTLDNPYEYENSFNYHSFLTEHQ                                     421 - 457

Text Mined References (6)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7649249 1995 Repression of transcriptional activity by heterologous KRAB domains present in zinc finger proteins.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.