Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.50
PubTator Score 7.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.100 5.5e-03
osteosarcoma -1.167 1.1e-02
group 3 medulloblastoma 2.400 6.2e-07
atypical teratoid / rhabdoid tumor 1.300 2.0e-04
glioblastoma 1.100 1.5e-03
medulloblastoma, large-cell 3.000 1.3e-06
primitive neuroectodermal tumor 1.700 1.6e-03
lung cancer 1.300 3.0e-03
active ulcerative colitis -1.242 4.9e-02
non primary Sjogren syndrome sicca -1.600 1.5e-02
subependymal giant cell astrocytoma 1.542 4.3e-02
Pick disease 1.800 3.4e-04

Gene RIF (1)

PMID Text
22082156 Knockdown of zinc finger protein 124 (ZNF124) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLASIGNKGEDQSIEDQYKNSSR      1 - 70
NLRHIISHSGNNPYGCEECGKKPCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIH     71 - 140
QRNHTGEKPYECMECGKALGFSRSLNRHKRIHTGEKRYECKQCGKAFSRSSHLRDHERTHTGEKPYECKH    141 - 210
CGKAFRYSNCLHYHERTHTGEKPYVCMECGKAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKH    211 - 280
EKTHIAQKPYVCNNCGKGFRCSSSLRDHERTHTGEKPYECQKCGKAFSRASTLWKHKKTHTGEKPYKCKK    281 - 350
M//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21314694 2011 Genomewide association analysis of symptoms of alcohol dependence in the molecular genetics of schizophrenia (MGS2) control sample.
17431901 2007 Dandy-Walker complex in a boy with a 5 Mb deletion of region 1q44 due to a paternal t(1;20)(q44;q13.33).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12142086 2002 Expression of the Krüppel-type zinc finger gene, ZK7, in head and neck squamous cell carcinoma and normal mucosa.
10667597 2000 ZK7, a novel zinc finger gene, is induced by vascular endothelial growth factor and inhibits apoptotic death in hematopoietic cells.
7916577 1993 A novel zinc finger gene on human chromosome 1qter that is alternatively spliced in human tissues and cell lines.