Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.10
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.300 1.9e-02
ependymoma 1.800 7.4e-03
psoriasis -2.700 7.0e-05
glioblastoma 1.500 4.8e-04
oligodendroglioma 1.300 5.3e-14
osteosarcoma -2.172 5.2e-04
group 4 medulloblastoma 2.700 3.3e-07
atypical teratoid / rhabdoid tumor 2.100 2.2e-07
medulloblastoma, large-cell 1.900 4.2e-05
primitive neuroectodermal tumor 1.800 1.7e-05
tuberculosis and treatment for 3 months 1.200 4.3e-04
intraductal papillary-mucinous carcinoma... 1.500 3.6e-02
lung cancer -2.800 9.8e-05
colon cancer 1.100 3.3e-02
adult high grade glioma 1.400 1.3e-03
ovarian cancer 1.200 1.5e-04
pituitary cancer 1.100 1.2e-03

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKRHEMVAKHLVMFYYFAQHLWPEQNIRDSFQKVTLRRYRKCGYENLQLRKGCKSVVECKQHKGDYSGLN      1 - 70
QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCMLSHLTQHKRIQTRVNFYKCE     71 - 140
AYGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSHLIRHKRIHTEEKPYKCEECGKAFNQSSTLTT    141 - 210
HNIIHTGEIPYKCEKCVRAFNQASKLTEHKLIHTGEKRYECEECGKAFNRSSKLTEHKYIHTGEKLYKCE    211 - 280
ECGKAFNQSSTLTTHKRIHSGEKPYKCEECGKAFKQFSNLTDHKKIHTGEKPYKCEECGKAFNQLSNLTR    281 - 350
HKVIHTGEKPYKCGECGKAFNQSSALNTHKIIHTGENPHKCRESGKVFHLSSKLSTCKKIHTGEKLYKCE    351 - 420
ECGKAFNRSSTLIGHKRIHTGEKPYKCEECGKAFNQSSTLTTHKIIHTEEKQYKCDECGKAST           421 - 483
//

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2505992 The human genome contains hundreds of genes coding for finger proteins of the Krüppel type.
2115127 1990 Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Krüppel.
2023909 1991 The evolutionarily conserved Krüppel-associated box domain defines a subfamily of eukaryotic multifingered proteins.
1427907 1992 Localization of the human KRAB finger gene ZNF117 (HPF9) to chromosome 7q11.2.