Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 5.4e-08
nasopharyngeal carcinoma 1056 2.9e-04
interstitial cystitis 2299 6.4e-04
lung cancer 4473 1.4e-03
Breast cancer 3098 2.5e-02
group 3 medulloblastoma 2254 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.600 1.4e-03
Breast cancer 3.500 2.5e-02
interstitial cystitis -1.200 6.4e-04
group 3 medulloblastoma 1.100 3.9e-02
nasopharyngeal carcinoma 1.200 2.9e-04
ovarian cancer -1.900 5.4e-08

AA Sequence

MTKFQEMVTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLISQLEREEKLLMVE      1 - 70
TETPRDGCSGRKNQQKMESIQEVTVSYFSPKELSSRQTWQQSAGGLIRCQDFLKVFQGKNSQLQEQGNSL     71 - 140
GQVWAGIPVQISEDKNYIFTHIGNGSNYIKSQGYPSWRAHHSWRKMYLKESHNYQCRCQQISMKNHFCKC    141 - 210
DSVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFH    211 - 280
LEGKPYTYSSCGKGCNYSSLLHIHQNIEREDDIENSHLKSYQRVHTEEKPCKCGEYGENFNHCSPLNTYE    281 - 350
LIHTGEMSYRHNIYEKAFSHSLDLNSIFRVHTRDEPHEYEENENVFNQSSCLQVHQKIHTEEKLYTDIEY    351 - 420
GKSFICSSNLDIQHRVHMEENSYNSEECGNGFSLASHFQDLQIVHTKEQPYKRYVCSNSFSHNLYLQGHP    421 - 490
KIHIGEKPRKEHGNGFNWSSKLKDHQRVHTGQKPYKCNICGKGFNHRSVLNVHQRVHTGEKPYKCEECDK    491 - 560
GFSRSSYLQAHQRVHTGEKPYKCEECGKGFSRNSYLQGHQRVHTGEKPYKCEECGKGFSRSSHLQGHQRV    561 - 630
HTGEKPFKCEECGKGFSWSFNLQIHQRVHTGEKPYKCEECGKGFSKASTLLAHQRVHTGEKPYQCDECGK    631 - 700
SFSQRSYLQSHQSVHSGERPYICEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAHRRV    701 - 770
HTGGKPYKCEVCTKGFSESSRLQAHQRVHVEGRPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEVCGK    771 - 840
GFSQRSNLQAHQRVHTGEKPYKCDACGKGFRWSSGLLIHQRVHSSDKFYKSEDYGKDYPSSENLHRNEDS    841 - 910
VLF                                                                       911 - 913
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12743021 2003 Differential expansion of zinc-finger transcription factor loci in homologous human and mouse gene clusters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.