Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.13
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.200 3.4e-07
cutaneous lupus erythematosus -1.100 1.4e-02
psoriasis -2.000 8.7e-05
osteosarcoma -1.184 6.0e-04
atypical teratoid / rhabdoid tumor 1.100 7.2e-06
medulloblastoma 1.500 2.4e-06
medulloblastoma, large-cell 1.100 3.3e-04
primitive neuroectodermal tumor 1.100 8.2e-04
adrenocortical carcinoma -1.071 8.5e-04
tuberculosis -1.500 1.3e-03
lung cancer -1.200 3.1e-03
lung carcinoma 1.600 3.2e-22

Gene RIF (2)

PMID Text
26096782 results indicate that ZNF10 could be involved in a potent intrinsic antiretroviral defense
24498343 Data indicate that Xenopus laevis XFIN-AB displayed reduced potency in repression compared to human ZNF10 KRAB-AB.

AA Sequence

MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKPDVILRLEKGE      1 - 70
EPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARNDLWYLSLEEVWKCRDQLDKYQ     71 - 140
ENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLVLREYFHKRDSHTKSLKHDLVLNGHQDSCAS    141 - 210
NSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNL    211 - 280
TRHQLIHTGEKPYECKECGKSFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYT    281 - 350
CNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL    351 - 420
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQRIHTGEKPYE    421 - 490
CCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTALVNTSNL    491 - 560
IGYQTNHIRENAY                                                             561 - 573
//

Text Mined References (16)

PMID Year Title
26096782 2015 ZNF10 inhibits HIV-1 LTR activity through interaction with NF-?B and Sp1 binding motifs.
24498343 2014 The B-subdomain of the Xenopus laevis XFIN KRAB-AB domain is responsible for its weaker transcriptional repressor activity compared to human ZNF10/Kox1.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11405226 2001 Transcriptional repression mediated by the KRAB domain of the human C2H2 zinc finger protein Kox1/ZNF10 does not require histone deacetylation.
10748030 2000 Biochemical analysis of the Kruppel-associated box (KRAB) transcriptional repression domain.
9278146 1997 Silencing of RNA polymerases II and III-dependent transcription by the KRAB protein domain of KOX1, a Krüppel-type zinc finger factor.
9016654 1996 Transcriptional repression by RING finger protein TIF1 beta that interacts with the KRAB repressor domain of KOX1.
8262519 1993 Chromosomal localization of 9 KOX zinc finger genes: physical linkages suggest clustering of KOX genes on chromosomes 12, 16, and 19.
7865130 1995 Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937.
7649249 1995 Repression of transcriptional activity by heterologous KRAB domains present in zinc finger proteins.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
2014798 1991 Twenty-seven nonoverlapping zinc finger cDNAs from human T cells map to nine different chromosomes with apparent clustering.