Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.00
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 6.6e-08
osteosarcoma 7933 1.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.140 1.1e-03
ovarian cancer 1.500 6.6e-08

Gene RIF (2)

PMID Text
16039987 Our results suggest that MIZIP might play an important role in mammalian cells by associating with tubulin and thus might provide a link between MCHR1 and tubulin functions.
12208518 was identified from human brain and interacts with the C-terminus of melanin-concentrating hormone receptor 1

AA Sequence

MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHE      1 - 70
LLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQ     71 - 140
FPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKK    141 - 210
HCRERKRPFQHELEPER                                                         211 - 227
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16039987 2005 MYND domain specific interaction of the melanin-concentrating hormone receptor 1 interacting zinc-finger protein with alpha- and beta-tubulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12208518 2002 MIZIP, a highly conserved, vertebrate specific melanin-concentrating hormone receptor 1 interacting zinc-finger protein.