Property Summary

NCBI Gene PubMed Count 28
PubMed Score 32.01
PubTator Score 29.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma 1.100 1.7e-02
oligodendroglioma 1.400 2.0e-03
psoriasis -2.100 2.1e-04
glioblastoma -1.200 1.1e-03
atypical teratoid / rhabdoid tumor 1.100 9.5e-04
medulloblastoma, large-cell -1.100 5.4e-04
ulcerative colitis -1.111 2.3e-02
adult high grade glioma -1.100 1.6e-06
group 4 medulloblastoma 1.100 3.4e-02
aldosterone-producing adenoma -1.271 3.3e-02
Pick disease -1.100 3.4e-05
progressive supranuclear palsy -1.300 5.6e-03
Breast cancer -1.200 1.2e-11
ovarian cancer -1.800 1.4e-07
Down syndrome 1.200 7.0e-03

Gene RIF (16)

PMID Text
26608508 In this study, we show that this translocation results in an in-frame translocation fusing exon 12 of the tumor suppressor gene ZMYND11 to exon 3 of the chromatin protein MBTD1, encoding a protein of 1,054 amino acids
25263594 this study identifies an H3.3K36me3-specific reader and a regulator of intron retention and reveals that BS69 connects histone H3.3K36me3 to regulated RNA splicing, providing significant, important insights into chromatin regulation of pre-mRNA processing.
24795016 ZMYND11 represses gene expression by binding H3.3K36me3 and preventing transcription elongation.
24675531 We propose that BS69 specifically associates with H3K36me3-enriched chromatin through the PWWP domain, which facilitates the recruitment of MYND-bound transcription and chromatin remodeling factors
24590075 identification of ZMYND11 as an H3.3-specific reader of H3K36me3 that links the histone-variant-mediated transcription elongation control to tumor suppression
20732415 BRAM1 acts as a negative signal regulator located at the very proximal end of lymphotoxin beta receptor complex assembly.
20425112 Data show significant association between the copy number variations of BS69 and some hematological malignancies.
20138174 Data found that BS69 directly interacted with TRAF3, a negative regulator of NF-kappaB activation. Results revealed that TRAF3 was involved in the BS69-mediated suppression of LMP1/CTAR1-induced NF-kappaB activation.
19795416 Knockdown of BS69 resulted in a decrease of IFN-beta induction, suggesting that BS69 is a positive regulator for the TLR3-TICAM-1 pathway and negative regulatory properties in NF-kappaB activation.
19766626 BS69 forms oligomers. The PHD and MYND domains are important for the cellular localization of BS69. PIAS1 and Ubc9 interact with BS69 and promote the sumoylation of BS69. BS69 plays inhibitory roles in both muscle and neuron differentiation.
17721438 Data indicate that BS69 is involved in cellular senescence mainly through the p53-p21Cip1 pathway.
16565076 BS69 has roles in gene repression and chromatin remodeling
16382137 The recruitment and aggregation of BS69 is a prerequisite for JNK activation by LMP1.
16300738 BS69 controls E1A stability via inhibition of ubiquitination.
11733528 the C-terminal Mynd domain of BS69 (amino acids 516-561) or Mynd domains of the Caenorhabditis elegans proteins Bra-1 and Bra-2 bind not only to E1A but also to the Epstein-Barr virus EBNA2 oncoprotein and the Myc-related cellular protein MGA
10734313 The adenovirus E1A binding protein BS69 is a corepressor of transcription through recruitment of N-CoR.

AA Sequence

MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLT      1 - 70
VGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPW     71 - 140
QCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKY    141 - 210
RSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPN    211 - 280
HELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL    281 - 350
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS    351 - 420
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRET    421 - 490
ERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKK    491 - 560
QWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR                                561 - 602
//

Text Mined References (42)

PMID Year Title
26608508 2016 Recurrent translocation t(10;17)(p15;q21) in minimally differentiated acute myeloid leukemia results in ZMYND11/MBTD1 fusion.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25263594 2014 BS69/ZMYND11 reads and connects histone H3.3 lysine 36 trimethylation-decorated chromatin to regulated pre-mRNA processing.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25217958 2014 Refining analyses of copy number variation identifies specific genes associated with developmental delay.
24795016 2014 The putative tumor suppressor ZMYND11 recognizes H3.3K36me3.
24675531 2014 Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
24590075 2014 ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.
23915195 2014 Recurrent translocation (10;17)(p15;q21) in acute poorly differentiated myeloid leukemia likely results in ZMYND11-MBTD1 fusion.
23372760 2013 Structural and functional analysis of the DEAF-1 and BS69 MYND domains.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20732415 2011 The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization.
20425112 2010 Analysis of copy number variations of BS69 in multiple types of hematological malignancies.
20138174 2010 BS69 cooperates with TRAF3 in the regulation of Epstein-Barr virus-derived LMP1/CTAR1-induced NF-kappaB activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19795416 2009 Oligomerized TICAM-1 (TRIF) in the cytoplasm recruits nuclear BS69 to enhance NF-kappaB activation and type I IFN induction.
19766626 2009 BS69 undergoes SUMO modification and plays an inhibitory role in muscle and neuronal differentiation.
19379743 2009 BS69 negatively regulates the canonical NF-kappaB activation induced by Epstein-Barr virus-derived LMP1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17721438 2007 BS69 is involved in cellular senescence through the p53-p21Cip1 pathway.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16565076 2006 New insights into BS69 functions.
16382137 2006 BS69, a specific adaptor in the latent membrane protein 1-mediated c-Jun N-terminal kinase pathway.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16300738 2006 Ubiquitin-dependent degradation of adenovirus E1A protein is inhibited by BS69.
15947784 2005 Binding of EMSY to HP1beta: implications for recruitment of HP1beta and BS69.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651845 2003 EMSY links the BRCA2 pathway to sporadic breast and ovarian cancer.
12894593 Ets-2 interacts with co-repressor BS69 to repress target gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12181323 2002 Negative regulation of Epstein-Barr virus latent membrane protein 1-mediated functions by the bone morphogenetic protein receptor IA-binding protein, BRAM1.
11733528 2002 The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif.
11148209 2001 The 8-kDa dynein light chain binds to its targets via a conserved (K/R)XTQT motif.
10734313 2000 The adenovirus E1A binding protein BS69 is a corepressor of transcription through recruitment of N-CoR.
9663660 1998 BRAM1, a BMP receptor-associated molecule involved in BMP signalling.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7621829 1995 BS69, a novel adenovirus E1A-associated protein that inhibits E1A transactivation.