Property Summary

NCBI Gene PubMed Count 31
PubMed Score 34.11
PubTator Score 29.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 1.6e-06
aldosterone-producing adenoma -1.271 3.3e-02
atypical teratoid / rhabdoid tumor 1.100 9.5e-04
Breast cancer -1.200 1.2e-11
Down syndrome 1.200 7.0e-03
ependymoma 1.100 1.7e-02
glioblastoma -1.200 1.1e-03
group 4 medulloblastoma 1.100 3.4e-02
medulloblastoma, large-cell -1.100 5.4e-04
oligodendroglioma 1.400 2.0e-03
ovarian cancer -1.800 1.4e-07
Pick disease -1.100 3.4e-05
progressive supranuclear palsy -1.300 5.6e-03
psoriasis -2.100 2.1e-04
ulcerative colitis -1.111 2.3e-02

Gene RIF (18)

AA Sequence

MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLT      1 - 70
VGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPW     71 - 140
QCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKY    141 - 210
RSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPN    211 - 280
HELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL    281 - 350
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS    351 - 420
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRET    421 - 490
ERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKK    491 - 560
QWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR                                561 - 602
//

Text Mined References (46)

PMID Year Title