Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.06
PubTator Score 4.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 2.8e-06
psoriasis -2.600 6.4e-05
medulloblastoma, large-cell -1.200 4.6e-03
primitive neuroectodermal tumor 1.100 7.9e-04
pancreatic ductal adenocarcinoma liver m... 1.051 2.3e-02
lung cancer -1.400 3.8e-03
aldosterone-producing adenoma -1.124 3.1e-02
Pick disease 1.200 4.7e-06
gastric carcinoma 1.500 1.1e-02
ovarian cancer -1.200 2.0e-06

AA Sequence

MEKCSVGGLELTEQTPALLGNMAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDDVVFIESIQPPS      1 - 70
ISAPAIADQRNFIFASSKNEKPQGNYSVIPPSSRDLASQKGNISETIVIDDEEDIETNGGAEKKSSCFIE     71 - 140
WGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGDLFQNGEFATHHSPDSWISQSASFPSNQK    141 - 210
QPGVDSLSPVALLRKQNFQPTAQQQLTKPAKITCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKR    211 - 280
TQNTRSIICKKDASTKKANVILPVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHE    281 - 350
VSVNNVTHKLCSNHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMME    351 - 420
TKSKKLTASENRKRNAFREENEKQLYGSSNTLLKKIEGIPEKKEKTSQLQLSVECGTDTLLIQENVNLPP    421 - 490
SSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVPPQVRNFNFPKDNTGRKFS    491 - 560
ETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNENGCKDWQHLSHILSKHEESEMHVN    561 - 630
NSVKYSKLKSDLKKNKAIDAAEHRLYENEKNDGVLLLYT                                   631 - 669
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
20036849 2010 Transcriptional regulation of the presenilin-1 gene controls gamma-secretase activity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17126306 2007 Analysis of transcriptional modulation of the presenilin 1 gene promoter by ZNF237, a candidate binding partner of the Ets transcription factor ERM.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10894931 2000 Cloning of ZNF237, a novel member of the MYM gene family that maps to human chromosome 13q11-->q12.