Property Summary

NCBI Gene PubMed Count 48
PubMed Score 34.49
PubTator Score 14.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.400 3.1e-03
osteosarcoma -1.457 8.8e-03
chronic lymphosyte leukemia -1.800 4.7e-13
astrocytoma 1.900 8.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.149 5.6e-03
acute quadriplegic myopathy 1.053 7.0e-04
tuberculosis -1.300 2.6e-05
primary pancreatic ductal adenocarcinoma 1.275 1.4e-02
lung cancer -1.200 6.0e-03
acute myeloid leukemia 1.100 1.2e-03
pancreatic cancer 1.100 5.7e-03

 GO Function (1)

Gene RIF (18)

PMID Text
26624892 At the ZMIZ1 locus, we show that perturbation of ZMIZ1 expression in human islets and beta-cells influences exocytosis and insulin secretion, highlighting a novel role for ZMIZ1 in the maintenance of glucose homeostasis.
26522984 Targeting the NOTCH1-ZMIZ1 interaction might combat leukemic growth.
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
26163108 This case represents the first constitutional balanced translocation disrupting and fusing both MIZ-type containing and proline-rich 12 and provides clues for the potential function and effects of these in the central nervous system.
24667117 ZMIZ1 is a susceptibility gene for vitiligo in Chinese population.
23426136 ZMIZ1 is overexpressed in a significant percentage of human breast, ovarian, and colon cancers in addition to human squamous cell carcinomas, suggesting that ZMIZ1 may play a broader role in epithelial cancers.
23161489 ZMIZ1 and activated NOTCH1 are coexpressed in a subset of human T-ALL patients and cell lines.
20473688 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19929986 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19795399 Observational study of gene-disease association. (HuGE Navigator)
18007576 Fusion of ZMIZ1 to ABL1 is associated with a B-cell acute lymphoblastic leukemia with a t(9;10)(q34;q22.3) translocation
17967885 provides evidence to demonstrate a crucial role for Zimp10 in vasculogenesis
17584785 Expression of exogenous hZimp10 enhances the transcriptional activity of p53 and knockdown of endogenous hZimp10 reduces the transcriptional activity of p53.
17512505 (RAI17) was found to be upregulated in WT-Add1 vs MUT-Add1 overexpressing cells, possibly representing a key molecule/axis for the functional Add1-induced effect
16777850 First line of evidence demonstrates a physiological role for endogenous Zimp10 in regulating Smad3/4-mediated transcription.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFD      1 - 70
LDLGYRLLAVCAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDPPGKLPMQPPLSSMSSMKPTLS     71 - 140
HSDGSFPYDSVPWQQNTNQPPGSLSVVTTVWGVTNTSQSQVLGNPMANANNPMNPGGNPMASGMTTSNPG    141 - 210
LNSPQFAGQQQQFSAKAGPAQPYIQQSMYGRPNYPGSGGFGASYPGGPNAPAGMGIPPHTRPPADFTQPA    211 - 280
AAAAAAAVAAAAATATATATATVAALQETQNKDINQYGPMGPTQAYNSQFMNQPGPRGPASMGGSMNPAS    281 - 350
MAAGMTPSGMSGPPMGMNQPRPPGISPFGTHGQRMPQQTYPGPRPQSLPIQNIKRPYPGEPNYGNQQYGP    351 - 420
NSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNY    421 - 490
SQGNVNRPPRPVPVANYPHSPVPGNPTPPMTPGSSIPPYLSPSQDVKPPFPPDIKPNMSALPPPPANHND    491 - 560
ELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTLMWRSDLELQFKCYHHEDRQMNTNWPASVQV    561 - 630
SVNATPLTIERGDNKTSHKPLHLKHVCQPGRNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLL    631 - 700
PAEHCITKIKRNFSSVAASSGNTTLNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCKHVQCFDLESYL    701 - 770
QLNCERGTWRCPVCNKTALLEGLEVDQYMWGILNAIQHSEFEEVTIDPTCSWRPVPIKSDLHIKDDPDGI    771 - 840
PSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGGTNSNDYSSQGNNYQGHGNFDFPHGNPGGTS    841 - 910
MNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQETMPHAGSSDQPHPSIQQGLHVPHPSSQSGPPLHHSG    911 - 980
APPPPPSQPPRQPPQAAPSSHPHSDLTFNPSSALEGQAGAQGASDMPEPSLDLLPELTNPDELLSYLDPP    981 - 1050
DLPSNSNDDLLSLFENN                                                        1051 - 1067
//

Text Mined References (53)

PMID Year Title
26624892 2015 Transcript Expression Data from Human Islets Links Regulatory Signals from Genome-Wide Association Studies for Type 2 Diabetes and Glycemic Traits to Their Downstream Effectors.
26522984 2015 The PIAS-like Coactivator Zmiz1 Is a Direct and Selective Cofactor of Notch1 in T Cell Development and Leukemia.
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
26163108 2015 A de novo t(10;19)(q22.3;q13.33) leads to ZMIZ1/PRR12 reciprocal fusion transcripts in a girl with intellectual disability and neuropsychiatric alterations.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24667117 2014 A comprehensive association analysis confirms ZMIZ1 to be a susceptibility gene for vitiligo in Chinese population.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23426136 2013 Ectopic expression of Zmiz1 induces cutaneous squamous cell malignancies in a mouse model of cancer.
23161489 2013 Convergence of the ZMIZ1 and NOTCH1 pathways at C-MYC in acute T lymphoblastic leukemias.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22482804 2012 Combined analysis of genome-wide association studies for Crohn disease and psoriasis identifies seven shared susceptibility loci.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20526339 2010 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.
20473688 2010 Association between genome-wide association studies reported SNPs and pediatric-onset Crohn's disease in Canadian children.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
19929986 2009 Genome-wide SNP genotyping study using pooled DNA to identify candidate markers mediating susceptibility to end-stage renal disease attributed to Type 1 diabetes.
19915574 2009 Common variants at five new loci associated with early-onset inflammatory bowel disease.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
19525953 2009 Meta-analysis of genome scans and replication identify CD6, IRF8 and TNFRSF1A as new multiple sclerosis susceptibility loci.
18711365 2008 Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder.
18007576 2008 Fusion of ZMIZ1 to ABL1 in a B-cell acute lymphoblastic leukaemia with a t(9;10)(q34;q22.3) translocation.
17967885 2008 The PIAS-like protein Zimp10 is essential for embryonic viability and proper vascular development.
17584785 2007 The novel PIAS-like protein hZimp10 is a transcriptional co-activator of the p53 tumor suppressor.
17512505 2007 Role of rat alpha adducin in angiogenesis: null effect of the F316Y polymorphism.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16777850 2006 The novel PIAS-like protein hZimp10 enhances Smad transcriptional activity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15626329 2003 Are gene expression microarray analyses reliable? A review of studies of retinoic acid responsive genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14609956 2003 hZimp10 is an androgen receptor co-activator and forms a complex with SUMO-1 at replication foci.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.