Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.37
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGS      1 - 70
NCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYP     71 - 140
VGWPPVQELPPSLRAPPPGGWPLQPRVQWG                                            141 - 170
//

Text Mined References (10)

PMID Year Title