Property Summary

NCBI Gene PubMed Count 23
PubMed Score 19.03
PubTator Score 18.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -2.000 1.2e-07
psoriasis -2.300 1.3e-04
osteosarcoma 1.789 9.8e-04
group 4 medulloblastoma -3.000 1.9e-06
atypical teratoid / rhabdoid tumor -1.200 1.4e-03
medulloblastoma, large-cell -2.500 2.5e-04
juvenile dermatomyositis 1.277 6.7e-09
acute quadriplegic myopathy 1.350 8.2e-05
adrenocortical adenoma 1.004 1.2e-02
pancreatic ductal adenocarcinoma liver m... 1.217 5.9e-03
tuberculosis 1.100 3.6e-05
Hydrolethalus syndrome 1.178 3.9e-02
active ulcerative colitis 1.036 3.7e-02
diabetes mellitus -1.100 3.4e-03
cystic fibrosis -1.100 9.5e-03
pilocytic astrocytoma 1.600 5.5e-04
non primary Sjogren syndrome sicca -1.100 1.9e-02
acute myeloid leukemia 1.800 8.4e-03
lung carcinoma 1.200 7.4e-16
Pick disease 1.900 2.5e-06
progressive supranuclear palsy 1.100 2.3e-02
Breast cancer -1.400 1.6e-14
ovarian cancer -2.800 3.3e-10

Gene RIF (12)

PMID Text
25379706 expression of the p53 target Wig-1 is associated with HPV status and patient survival in cervical carcinoma
24469038 Results suggest a role of Wig-1 as a survival factor that directs the p53 stress response toward cell cycle arrest rather than apoptosis through the regulation of FAS and 14-3-3sigma mRNA levels.
23158102 PSF and MATR3 are cellular host factors that bind viral RNA and promote Rev activity.
23085987 The data indicated a novel role for Wig1 in RNA-induced silencing complex target accessibility, which is a key step in RNA-mediated gene silencing. Fine tuning of p21 levels by Wig1 was essential for the prevention of cellular senescence.
22513872 Wig-1 knockdown causes a dramatic inhibition of N-Myc expression and triggers differentiation in neuroblastoma cells carrying amplified N-Myc.
21559779 WIG-1 might be involved in the zinc-induced cell cycle arrest and apoptosis of human esophageal squamous cell carcinoma cells
21050045 WIG-1 might be a novel modifier in esophageal carcinogenesis, and the WIG-1 MAb should be useful in further study of the mechanism in WIG-1-related physiological reactions.
20962082 The cellular distribution of the nuclear matrix protein matrin 3 is altered by novel phosphorylation induced by the alphaherpesvirus US3 kinase family.
19805223 the p53 target Wig-1 is a previously undescribed AU-rich element-regulating protein that acts as a positive feedback regulator of p53, with implications both for the steady-state levels of p53 and for the p53 stress response
19127773 Data demonstrated a direct interaction between Dicer and Wig-1 and both may play a common role in dsRNA-related gene regulation.
18519039 Wig-1-binding proteins, hnRNP A2/B1 and RNA Helicase A, both of which are involved in RNA processing, were identified.
16844115 Results demonstrate that human Wig-1 can bind different types of double-stranded RNAs (dsRNAs), including dsRNAs resembling small interfering RNAs and microRNAs, and indicate that dsRNA binding has a role in Wig-1-mediated regulation of cell growth.

AA Sequence

MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL      1 - 70
YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV     71 - 140
ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR    141 - 210
NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR    211 - 280
NEMENLGYV                                                                 281 - 289
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25379706 2014 Expression of the p53 target Wig-1 is associated with HPV status and patient survival in cervical carcinoma.
24469038 2014 Wig-1 regulates cell cycle arrest and cell death through the p53 targets FAS and 14-3-3?.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23158102 2013 HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3.
23085987 2012 Wig1 prevents cellular senescence by regulating p21 mRNA decay through control of RISC recruitment.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22513872 2012 Wig-1, a novel regulator of N-Myc mRNA and N-Myc-driven tumor growth.
21559779 2011 Zinc induces cell cycle arrest and apoptosis by upregulation of WIG-1 in esophageal squamous cancer cell line EC109.
21050045 2010 Preparation of a novel monoclonal antibody specific for WIG-1 and detection of its expression pattern in human esophageal carcinoma.
20962082 2011 The alphaherpesvirus US3/ORF66 protein kinases direct phosphorylation of the nuclear matrix protein matrin 3.
19805223 2009 The p53 target Wig-1 regulates p53 mRNA stability through an AU-rich element.
19127773 2008 [Dicer interacts with Wig-1 protein].
18519039 2008 The p53 target protein Wig-1 binds hnRNP A2/B1 and RNA Helicase A via RNA.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16844115 2006 The p53-induced Wig-1 protein binds double-stranded RNAs with structural characteristics of siRNAs and miRNAs.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12196512 2002 The p53-activated gene, PAG608, requires a zinc finger domain for nuclear localization and oxidative stress-induced apoptosis.
11689294 2001 Cloning and chromosomal localization of human WIG-1/PAG608 and demonstration of amplification with increased expression in primary squamous cell carcinoma of the lung.
11571644 2001 Human wig-1, a p53 target gene that encodes a growth inhibitory zinc finger protein.
9400996 1997 Wig-1, a new p53-induced gene encoding a zinc finger protein.