Zinc finger matrin-type protein 2

Property Summary

NCBI Gene PubMed Count	7
PubMed Score	1.06

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression Atlas
JensenLab Text Mining

Disease	Target Count	P-value
atypical teratoid / rhabdoid tumor	5112	3.0e-06
medulloblastoma, large-cell	6241	1.5e-04
glioblastoma	5792	2.3e-04
ovarian cancer	8520	3.0e-03

Disease	Target Count	Z-score	Confidence
Chondrosarcoma	21	3.43	1.7

Expression

Specificity
Differential

Differential Expression (4)

Disease	log2 FC	p
atypical teratoid / rhabdoid tumor	-1.100	3.0e-06
glioblastoma	-1.100	2.3e-04
medulloblastoma, large-cell	-1.100	1.5e-04
ovarian cancer	1.300	3.0e-03

Brain - Frontal Cortex (BA9) 18,069

Cells - EBV-transformed lymphocytes 18,186

Brain - Cerebellar Hemisphere 18,015

Brain - Nucleus accumbens (basal ganglia... 18,024

Cells - Transformed fibroblasts 17,577

Artery - Aorta 17,896

Artery - Tibial 17,631

Spleen 17,614

Ovary 17,971

Uterus 17,618

Brain - Cerebellum 17,983

Skin - Not Sun Exposed (Suprapubic) 18,081

Brain - Caudate (basal ganglia) 18,001

Skin - Sun Exposed (Lower leg) 17,968

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Cortex 18,039

Thyroid 18,024

Small Intestine - Terminal Ileum 17,954

Vagina 17,834

Esophagus - Mucosa 18,076

Adipose - Visceral (Omentum) 17,937

Artery - Coronary 17,949

Nerve - Tibial 18,007

Breast - Mammary Tissue 18,103

Pituitary 18,147

Adipose - Subcutaneous 18,110

Colon - Sigmoid 18,089

Lung 18,057

Brain - Spinal cord (cervical c-1) 17,973

Brain - Hypothalamus 18,169

Brain - Amygdala 18,006

Brain - Putamen (basal ganglia) 17,863

Prostate 18,213

Muscle - Skeletal 17,778

Testis 18,518

Minor Salivary Gland 18,005

Brain - Substantia nigra 17,981

Esophagus - Gastroesophageal Junction 18,000

Brain - Hippocampus 18,011

Esophagus - Muscularis 18,017

Adrenal Gland 18,071

Colon - Transverse 17,825

Stomach 17,879

Whole Blood 17,439

Kidney - Cortex 17,329

Heart - Atrial Appendage 17,896

Liver 18,071

Pancreas 18,123

Heart - Left Ventricle 18,006

CD8 Cells 9,840

B Cells 9,086

Adult Testis 10,836

Fetal Ovary 9,118

NK Cells 8,475

CD4 Cells 7,773

Adult Pancreas 9,168

Fetal Liver 8,402

Fetal Heart 9,228

Monocytes 7,422

Adult Prostate 8,952

Adult Adrenal 8,475

Adult Ovary 10,192

Adult Retina 10,115

Adult Rectum 8,022

Adult Gallbladder 7,612

Fetal Testis 7,955

Fetal Brain 7,866

Fetal Gut 8,640

Adult Colon 7,915

Adult Frontal Cortex 9,048

Adult Urinary Bladder 7,592

Adrenal gland

Brain

Colon

Frontal lobe

Gall bladder

Gut

Heart

Liver

B-lymphocyte

Monocyte

Natural killer cell

Ovary

Pancreas

Placenta 6,083

Rectum

Retina

Testis

BTO:0004410

BTO:0005453

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Liver 5,008

Testis 3,897

See source...

See source...

Synonym

Accession	Q96NC0
Symbols	Snu23 Ptg-12

Gene

ZMAT2

Ortholog (14)

Species	Source	Disease
Mouse 16,567	Inparanoid OMA EggNOG
Rat 15,112	Inparanoid OMA
Chimp 14,136	OMA EggNOG
Macaque 12,758	Inparanoid OMA EggNOG
Cow 15,316	Inparanoid OMA EggNOG
Pig 10,164	OMA EggNOG
Dog 15,069	Inparanoid OMA EggNOG
Horse 14,249	OMA EggNOG
Xenopus 10,463	Inparanoid OMA EggNOG
Zebrafish 9,725	Inparanoid OMA EggNOG
Platypus 5,699	OMA EggNOG
Anole lizard 10,585	Inparanoid OMA EggNOG
C. elegans 3,178	Inparanoid OMA EggNOG
S.cerevisiae 1,798	Inparanoid EggNOG

UniProt Keyword (11)

Complete proteome 20,231

DNA-binding 2,008

Metal-binding 3,672

Nucleus 5,259

Reference proteome 20,231

Zinc 2,356

Zinc-finger 1,785

Isopeptide bond 1,739

Ubl conjugation 2,439

Acetylation 3,409

See all...

GO Function (3)

DNA binding 1,481

zinc ion binding 828

RNA binding 1,383

GO Component (1)

U4-U6 x U5 tri-snRNP complex 23

GO Process (1)

mRNA splicing, via spliceosome 236

Compartment GO Term (23)

Cell 16,178

Cell part 16,177

GO:0097525 85

Intracellular 14,108

Intracellular membrane-bounded organelle 10,341

Intracellular organelle 12,025

Intracellular organelle part 8,784

Intracellular part 13,972

Intracellular ribonucleoprotein complex 850

Macromolecular complex 5,475

Mitochondria 998

Nuclear part 4,290

Nucleus 7,562

Organelle 12,238

Organelle part 8,976

See all...

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (1)

Spliceosome 132

PDB (1)

...
More...

AA Sequence

MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITK      1 - 70
TTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDY     71 - 140
DFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY               141 - 199
//

Text Mined References (12)

Summary
Details

	PMID	Year	Title