Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.12
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
medulloblastoma 1524 4.8e-08
lung cancer 4473 2.9e-05
hepatocellular carcinoma 550 3.2e-04
tuberculosis 1563 2.0e-03
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
hepatocellular carcinoma 1.200 3.2e-04
medulloblastoma 1.200 4.8e-08
tuberculosis -1.100 2.0e-03
lung cancer 1.800 2.9e-05

Gene RIF (2)

PMID Text
19008334 The SCAN- and KRAB-domain-containing zinc finger protein 307 (ZKSCAN4) was co-precipitated with the receptor when both proteins were overexpressed in HEK293 cells.
17910948 ZNF307 might suppress p53-p21 pathway through activating MDM2 and EP300 expression and inducing p53 degradation

AA Sequence

MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPERSRQRFRGFRYPEAAGPREA      1 - 70
LSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAP     71 - 140
QVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHESLGSQPLHDRVLQVPGLAQGGCCREDAMVA    141 - 210
SRLTPGSQGLLKMEDVALTLTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKE    211 - 280
HGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYEC    281 - 350
EDCGKTFIGSSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLL    351 - 420
EHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWENTEAPVSYKCN    421 - 490
ECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ                   491 - 545
//

Text Mined References (13)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22037552 2011 Genome-wide association study identifies a susceptibility locus for schizophrenia in Han Chinese at 11p11.2.
19008334 2009 A RAS recruitment screen identifies ZKSCAN4 as a glucocorticoid receptor-interacting protein.
17910948 2007 ZNF307, a novel zinc finger gene suppresses p53 and p21 pathway.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.