Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.15
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.190 1.4e-07
group 3 medulloblastoma 1.400 4.8e-05
atypical teratoid/rhabdoid tumor 1.200 1.8e-07
medulloblastoma, large-cell 1.100 8.3e-04
primitive neuroectodermal tumor 1.300 2.5e-04
lung cancer 1.200 1.3e-02
non primary Sjogren syndrome sicca -1.300 1.7e-02

Gene RIF (4)

PMID Text
23434374 Suggest ZKSCAN3 as an autophagy master switch regulating the expression of a transcriptional network of genes integral to autophagy and lysosome biogenesis/function.
21057542 ZKSCAN3 induction represents a mechanism by which myeloma cells can induce cyclin D2 dysregulation and contribute to disease pathogenesis.
18940803 ZKSCAN3 regulates the expression of several genes favoring tumor progression including integrin beta 4 and VEGF
18519692 ZKSCAN3 adds to an expanding set of encoded products contributing to the progression of colorectal cancer

AA Sequence

MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL      1 - 70
CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ     71 - 140
GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDKVVASRLTPES    141 - 210
QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH    211 - 280
LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA    281 - 350
FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH    351 - 420
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT    421 - 490
QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ                          491 - 538
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23434374 2013 ZKSCAN3 is a master transcriptional repressor of autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22531714 2012 The zinc finger transcription factor ZKSCAN3 promotes prostate cancer cell migration.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21057542 2011 Evidence of a role for the novel zinc-finger transcription factor ZKSCAN3 in modulating Cyclin D2 expression in multiple myeloma.
18940803 2008 Unbiased screening for transcriptional targets of ZKSCAN3 identifies integrin beta 4 and vascular endothelial growth factor as downstream targets.
18519692 2008 The previously undescribed ZKSCAN3 (ZNF306) is a novel "driver" of colorectal cancer progression.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15031282 2004 The Kruppel-like KLF4 transcription factor, a novel regulator of urokinase receptor expression, drives synthesis of this binding site in colonic crypt luminal surface epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10520746 1998 Computer sequence analysis of human highly conserved zinc finger modules.