Property Summary

NCBI Gene PubMed Count 21
PubMed Score 11.38
PubTator Score 5.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.300 1.3e-02
ependymoma 1.100 1.6e-02
oligodendroglioma 1.500 5.2e-03
osteosarcoma 2.481 9.5e-08
juvenile dermatomyositis 1.023 1.7e-11
tuberculosis and treatment for 6 months -1.400 5.0e-04
intraductal papillary-mucinous adenoma (... 1.400 3.5e-04
intraductal papillary-mucinous carcinoma... 1.200 2.5e-03
breast carcinoma 1.500 1.4e-02
group 3 medulloblastoma 1.300 1.1e-04
lung carcinoma 1.500 9.8e-25
ovarian cancer 1.900 5.0e-04

Gene RIF (5)

PMID Text
26722429 ZNF139 functions to promote apoptosis resistance of gastric cancer cells by regulating some apoptosis related genes.
25561801 ZNF139 expression is related to clinicopathologic characteristics and prognosis of gastric cancer. It is overexpressed and involved in apoptosis in GC tissues by regulating caspase-3.
25436386 ZNF139 gene may influence the biological behavior of gastric cancer cells in many ways by regulating multiple proteins.
24824930 Knocking down ZNF139 expression in gastric cancer cells could effectively reduce gastric cancer cell invasion and migration ability
24515389 ZNF139 was involved in GC MDR by promoting expressions of MDR1/P-gp, MRP1 and Bcl-2 and inhibiting Bax simultaneously.

AA Sequence

MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPPDPEIFRQRFRRFCYQNTFGP      1 - 70
REALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSG     71 - 140
QQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPR    141 - 210
DQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSK    211 - 280
AETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREK    281 - 350
GKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL    351 - 420
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYE    421 - 490
CSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERASEYSPASLDAFGAFLK    491 - 560
SCV                                                                       561 - 563
//

Text Mined References (31)

PMID Year Title
27698826 2016 Effects of ZNF139 on gastric cancer cells and mice with gastric tumors.
26722429 2015 Silencing of ZNF139-siRNA induces apoptosis in human gastric cancer cell line BGC823.
26013381 2015 Activating MET kinase rearrangements in melanoma and Spitz tumours.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25561801 2014 Zinc finger protein 139 expression in gastric cancer and its clinical significance.
25436386 2014 Comparative proteomics in gastric cancer cell line BGC823 after ZNF139 gene inhibited with RNA interference.
25416956 2014 A proteome-scale map of the human interactome network.
25281217 2014 Short intronic repeat sequences facilitate circular RNA production.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24824930 2014 ZNF139 promotes tumor metastasis by increasing migration and invasion in human gastric cancer cells.
24515389 2014 Regulatory mechanism of ZNF139 in multi-drug resistance of gastric cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.
7486829 1995 Chromosomal localization of two KOX zinc finger genes on chromosome bands 7q21-q22.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
2014798 1991 Twenty-seven nonoverlapping zinc finger cDNAs from human T cells map to nine different chromosomes with apparent clustering.