Property Summary

NCBI Gene PubMed Count 27
PubMed Score 38.28
PubTator Score 1020.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 3.7e-06
astrocytoma 1.800 3.6e-02
ependymoma 1.900 1.4e-02
oligodendroglioma 1.800 9.1e-03
psoriasis -2.900 3.6e-05
osteosarcoma -2.320 5.2e-05
tuberculosis -2.000 2.2e-09
intraductal papillary-mucinous carcinoma... -1.100 3.0e-03
lung cancer -2.000 1.4e-05
ulcerative colitis 1.600 3.0e-05

Gene RIF (17)

PMID Text
26679602 These results indicated that ZHX2 plays a critical role in the proliferation and osteo/odontogenic differentiation of SCAPs.
25746325 Two novel markers, rs7840785 (PINX1) and rs7844465 (ZHX2), are significantly associated with carotid intima-media thickness.
25473899 Data show that Zinc-fingers and homeoboxes 2 (ZHX2) represses nuclear transcription factor Y alpha (NF-Y)-mediated activation of multidrug resistance 1 (MDR1) transcription.
25195714 Data indicate that zinc-fingers and homeoboxes 2 (ZHX2) suppresses glypican 3 (GPC3) transcription by binding with its core promoter.
22984075 Expression of a constitutively active Raf transgene enhances lymphoproliferation, indicating a role for the Ras-MAPK pathway in linker for activation of T cells (LAT)-mediated autoimmune hyperproliferation.
22661463 simultaneous application of ZFN and rescue DNA induced gene repair of the disease-causing mutation on the genomic level, resulting in recovery of protein expression.
22078940 results demonstrate multiple mechanisms decreasing expression of tumor suppressor gene ZHX2 in Hodgkin lymphoma cell lines
21987443 Expression profiling of L-1236 cells following siRNA-mediated knockdown of ZHX2 showed inhibition of genes regulating differentiation and apoptosis, suggesting tumor suppressor activity of ZHX2.
21443521 There was no significant difference in high and low percentage of HbF in GG, GA, and AA bearing individuals showing that ZHX2 gene variant has no role in ameliorating the severity of beta-thalassemia major in the South Indian population from Andhra Pradesh.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18194454 These data support the idea that ZHX2 contributes to AFP repression in the liver after birth and may also be involved in AFP reactivation in liver cancer.
17447851 High ZHX2 is associated with metastasis in hepatocellular carcinoma.
17056598 ZHX proteins 1, 2 and 3 are major transcriptional mediators of podocyte disease
16952470 ZHX2, a transcriptional repressor, may participate in globin gene regulation.
12741956 identification as a transcriptional repressor

AA Sequence

MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEVIEVKSMGESQ      1 - 70
SKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGEANFK     71 - 140
LKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGISVSKTPIMKPGKPKADAKKVPKKPEEITPEN    141 - 210
HVEGTARLVTDTAEILSRLGGVELLQDTLGHVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINS    211 - 280
FNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPA    281 - 350
QLAPTKVTQPILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKR    351 - 420
PHIAQVPEPPPKVANPPLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDH    421 - 490
RYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELD    491 - 560
RLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPS    561 - 630
PAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMA    631 - 700
DDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSD    701 - 770
RSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA       771 - 837
//

Text Mined References (31)

PMID Year Title
26679602 2016 Proliferation and osteo/odontogenic differentiation of stem cells from apical papilla regulated by Zinc fingers and homeoboxes 2: An in vitro study.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25746325 2015 Genetic association and gene-smoking interaction study of carotid intima-media thickness at five GWAS-indicated genes: the Bogalusa Heart Study.
25473899 2015 ZHX2 enhances the cytotoxicity of chemotherapeutic drugs in liver tumor cells by repressing MDR1 via interfering with NF-YA.
25195714 2014 Reduced nucleic ZHX2 involves in oncogenic activation of glypican 3 in human hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22984075 2012 The importance of the Erk pathway in the development of linker for activation of T cells-mediated autoimmunity.
22661463 2012 Gene repair of an Usher syndrome causing mutation by zinc-finger nuclease mediated homologous recombination.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22078940 2012 Transcriptional deregulation of homeobox gene ZHX2 in Hodgkin lymphoma.
21987443 2011 t(4;8)(q27;q24) in Hodgkin lymphoma cells targets phosphodiesterase PDE5A and homeobox gene ZHX2.
21909108 2011 Meta-analysis of genome-wide association studies from the CHARGE consortium identifies common variants associated with carotid intima media thickness and plaque.
21443521 2011 Lack of association of G779A ZHX-2 gene variant with HbF levels in ?-thalassemia major.
20509910 2010 Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18194454 2008 ZHX2 is a repressor of alpha-fetoprotein expression in human hepatoma cell lines.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17447851 2007 Expression of zinc-fingers and homeoboxes 2 in hepatocellular carcinogenesis: a tissue microarray and clinicopathological analysis.
17056598 2006 ZHX proteins regulate podocyte gene expression during the development of nephrotic syndrome.
16952470 Identification of novel candidate genes for globin regulation in erythroid cells containing large deletions of the human beta-globin gene cluster.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14659886 2003 The mouse zinc-fingers and homeoboxes (ZHX) family; ZHX2 forms a heterodimer with ZHX3.
12741956 2003 Zinc-fingers and homeoboxes (ZHX) 2, a novel member of the ZHX family, functions as a transcriptional repressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.