Property Summary

NCBI Gene PubMed Count 29
PubMed Score 222.79
PubTator Score 22.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -2.297 8.1e-09
Atopic dermatitis 1.800 1.6e-03
adrenocortical carcinoma 1.279 3.5e-02
pancreatic ductal adenocarcinoma liver m... 1.142 2.3e-02
intraductal papillary-mucinous adenoma (... 2.200 4.2e-04
intraductal papillary-mucinous carcinoma... 2.200 7.6e-03
intraductal papillary-mucinous neoplasm ... 3.500 4.5e-04
active Crohn's disease 1.626 3.0e-02
active ulcerative colitis 2.459 4.6e-03
pancreatic cancer 2.400 9.7e-08
lung cancer -2.700 2.3e-02
breast carcinoma 2.300 6.7e-04
fibroadenoma 2.900 4.3e-03
interstitial cystitis -1.600 1.2e-03
cystic fibrosis 1.700 1.1e-02
psoriasis -1.100 2.0e-03
ductal carcinoma in situ 2.400 3.9e-02
invasive ductal carcinoma 2.400 5.4e-03
chronic rhinosinusitis 3.389 2.6e-03

Synonym

Accession Q96DA0 A6NIY1 B2R4F6 Q6UW28
Symbols EECP
PAUF
JCLN2
HRPE773
PRO1567

Gene

PDB

3AQG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

PMID Text
26336989 PAUF mediated dendritic cell activation and immune stimulation are dependent on TLR4
25727013 constitutive suppression of PAUF sensitized Bxpc3 pancreatic cancer cells to oncolytic parvovirus H-1 infection
25079514 PAUF rs12373A>C polymorphisms are associated with colorectal cancer.
23677445 PAUF-siRNA inhibited the proliferation of colorectal cancer cells, promoted their apoptosis and induced G0/G1 cell cycle arrest. At the same time, PAUF-siRNA inhibited the invasion, adhesion and migration of the tumor cells.
22907431 new possibilities for PAUF's role in the pathogenesis of angiogenesis-dependent diseases
22640743 activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin.
21464589 PAUF-mediated FAK activation plays an important role in pancreatic cancer progression.
21196815 PAUF can up-regulate and stabilize beta-catenin via a novel pattern of phosphorylation, thereby contributing to the rapid proliferation of pancreatic cancer cells.
21110947 the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site.
20858015 Data demonstrate that the host salivary protein CSP-1 (HRPE773 GenBank AAQ89380.1) binds to S. mutans cells and may influence the initial colonization of this pathogenic bacterium onto the tooth surface.
20802527 PAUF is a mammalian lectin normally found in plant lectins. PAUF induces extracellular signal-regulated kinase phosphorylation and activates the IKK-b-mediated TPL2/MEK/ERK signaling pathway through TLR2.
19784070 Findings indicate that PAUF enhances the metastatic potential of pancreatic cancer cells, at least in part, by upregulating CXCR4 expression.
19302292 pancreatic adenocarcinoma up-regulated factor was secreted into the culture medium of pancreatic adenocarcinoma up-regulated factor-overexpressing Chinese hamster ovary cells, had an apparent molecular mass of approximately 25 kDa, and was N-glycosylated
16954406 Bioinformatic analysis identified a putative human CSP-1/Dcpp ortholog, HRPE773, expressed predominantly in human salivary tissue, that shows 31% amino acid identity and 45% amino acid similarity to the mouse Dcpp query sequence.

AA Sequence

MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDY      1 - 70
DHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKD     71 - 140
RYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR      141 - 208
//

Text Mined References (31)

PMID Year Title
26336989 2015 Pancreatic adenocarcinoma upregulated factor serves as adjuvant by activating dendritic cells through stimulation of TLR4.
25727013 2015 Pancreatic adenocarcinoma upregulated factor (PAUF) confers resistance to pancreatic cancer cells against oncolytic parvovirus H-1 infection through IFNA receptor-mediated signaling.
25079514 2015 Genetic variation in microRNA-binding site and prognosis of patients with colorectal cancer.
23677445 2013 Silencing of pancreatic adenocarcinoma upregulated factor by RNA interference inhibits the malignant phenotypes of human colorectal cancer cells.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22907431 2013 Pancreatic adenocarcinoma upregulated factor, a novel endothelial activator, promotes angiogenesis and vascular permeability.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22640743 2012 SIRT1 inhibits proliferation of pancreatic cancer cells expressing pancreatic adenocarcinoma up-regulated factor (PAUF), a novel oncogene, by suppression of ?-catenin.
21464589 2011 PAUF promotes adhesiveness of pancreatic cancer cells by modulating focal adhesion kinase.
21196815 2011 Pancreatic adenocarcinoma up-regulated factor (PAUF) enhances the expression of ?-catenin, leading to a rapid proliferation of pancreatic cells.
21110947 2011 Crystal structures of human secretory proteins ZG16p and ZG16b reveal a Jacalin-related ?-prism fold.
20858015 2010 Human common salivary protein 1 (CSP-1) promotes binding of Streptococcus mutans to experimental salivary pellicle and glucans formed on hydroxyapatite surface.
20802527 2011 Pancreatic adenocarcinoma upregulated factor promotes metastasis by regulating TLR/CXCR4 activation.
19784070 2010 PAUF functions in the metastasis of human pancreatic cancer cells and upregulates CXCR4 expression.
19302292 2009 Pancreatic adenocarcinoma up-regulated factor (PAUF), a novel up-regulated secretory protein in pancreatic ductal adenocarcinoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16954406 2006 Identification of a human ortholog of the mouse Dcpp gene locus, encoding a novel member of the CSP-1/Dcpp salivary protein family.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11678034 2001 Mass spectrometry allows direct identification of proteins in large genomes.
11076863 2000 DNA cloning using in vitro site-specific recombination.