Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.07
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 9.8e-04
atypical teratoid / rhabdoid tumor -1.100 2.9e-04
Down syndrome 1.200 1.6e-04
esophageal adenocarcinoma -1.600 1.8e-02
group 4 medulloblastoma -1.400 1.5e-06
interstitial cystitis -1.400 3.3e-04
malignant mesothelioma -1.200 9.3e-06
medulloblastoma, large-cell -1.800 6.4e-05
ovarian cancer -1.100 8.8e-09
primary pancreatic ductal adenocarcinoma 1.232 3.0e-03
primitive neuroectodermal tumor -1.100 4.3e-02

Gene RIF (5)

AA Sequence

MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG      1 - 70
KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL     71 - 140
SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG    141 - 210
RRQAVAWLVAMHKAAKLLYESRDQ                                                  211 - 234
//

Text Mined References (13)

PMID Year Title