Property Summary

NCBI Gene PubMed Count 16
PubMed Score 155.48
PubTator Score 112.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.900 8.3e-06
glioblastoma -1.800 1.1e-02
medulloblastoma, large-cell 1.100 5.7e-04
intraductal papillary-mucinous neoplasm ... -1.300 2.4e-02
cystic fibrosis -3.000 6.0e-06
pediatric high grade glioma -1.500 1.7e-02
non primary Sjogren syndrome sicca -1.500 7.1e-03
spina bifida -1.923 3.8e-02
acute myeloid leukemia 2.200 2.5e-02

Gene RIF (1)

PMID Text
22407129 Studies identified a major testis-specific ZFY transcript that encodes a protein with the same short acidic domain.

AA Sequence

MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDPDSVVIQDVVE      1 - 70
DVVIEEDVQCSDILEEADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVLASDITSTSMSMPEHVLTSES     71 - 140
MHVCDIGHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVADCAPEAVIDASGISVDQQDNDKASCEDYLMI    141 - 210
SLDDAGKIEHDGSTGVTIDAESEMDPCKVDSTCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVEL    211 - 280
LDQNSSIRVPREKMVYMTVNDSQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAAAAVHEQQIDEDEMKT    281 - 350
FVPIAWAAAYGNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTV    351 - 420
YPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECG    421 - 490
KHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFRHPSELR    491 - 560
KHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQ    561 - 630
CLHCDHKSSNSSDLKRHVISVHTKDYPHKCEMCEKGFHRPSELKKHVAVHKGKKMHQCRHCDFKIADPFV    631 - 700
LSRHILSVHTKDLPFRCKRCRKGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDY    701 - 770
PHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP                                           771 - 801
//

Text Mined References (19)

PMID Year Title
22407129 2012 Human and mouse ZFY genes produce a conserved testis-specific transcript encoding a zinc finger protein with a short acidic domain and modified transactivation potential.
20028140 2010 Characterization of the DNA binding activity of the ZFY zinc finger domain.
15557258 2004 Solvation and the hidden thermodynamics of a zinc finger probed by nonstandard repair of a protein crevice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11750730 Onset of sex differentiation: dialog between genes and cells.
11173854 2000 Three thousand years of questioning sex determination.
10779541 2000 Sex chromosomal transposable element accumulation and male-driven substitutional evolution in humans.
7680890 1993 ZFY gene expression and retention in human prostate adenocarcinoma.
3690661 1987 The sex-determining region of the human Y chromosome encodes a finger protein.
2511751 1989 The putative testis-determining factor and related genes are expressed as discrete-sized transcripts in adult gonadal and somatic tissues.
2498838 1989 Evidence for distinguishable transcripts of the putative testis determining gene (ZFY) and mapping of homologous cDNA sequences to chromosomes X,Y and 9.
2497060 1989 Mapping the human ZFX locus to Xp21.3 by in situ hybridization.
2308929 1990 Comparison of human ZFY and ZFX transcripts.
2041734 1991 Comparison of ZFY and ZFX gene structure and analysis of alternative 3' untranslated regions of ZFY.
1854720 1991 Alternating zinc fingers in the human male associated protein ZFY: refinement of the NMR structure of an even finger by selective deuterium labeling and implications for DNA recognition.
1849423 1991 Alternating zinc fingers in the human male associated protein ZFY: 2D NMR structure of an even finger and implications for "jumping-linker" DNA recognition.