Property Summary

NCBI Gene PubMed Count 41
PubMed Score 57.45
PubTator Score 43.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
46 XY gonadal dysgenesis 9 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0
Disease Target Count
Conotruncal heart malformations 10

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -2.700 1.6e-08
psoriasis -1.300 1.2e-06
glioblastoma -1.900 4.5e-02
cystic fibrosis 1.440 1.4e-05
atypical teratoid / rhabdoid tumor -3.100 7.5e-04
medulloblastoma, large-cell 1.900 1.2e-02
primitive neuroectodermal tumor -2.200 2.0e-02
Amyotrophic Lateral Sclerosis 1.165 1.8e-04
Atopic dermatitis -1.300 3.3e-03
non-small cell lung cancer -1.146 6.8e-07
intraductal papillary-mucinous adenoma (... -1.800 1.8e-03
intraductal papillary-mucinous carcinoma... -1.800 2.0e-03
lung cancer -2.900 1.5e-05
colon cancer -1.900 3.3e-03
active Crohn's disease 3.092 5.9e-03
active ulcerative colitis 2.033 3.1e-02
fibroadenoma -1.600 1.1e-02
pediatric high grade glioma -1.500 4.2e-02
group 3 medulloblastoma 2.100 2.3e-02
subependymal giant cell astrocytoma -3.977 1.2e-02
lung carcinoma -1.700 2.1e-17
ductal carcinoma in situ -1.800 1.2e-02
invasive ductal carcinoma -2.200 2.4e-03
ovarian cancer -5.400 1.9e-11
pituitary cancer 4.000 1.7e-09

Gene RIF (22)

PMID Text
26207917 ZFPM2 is a glioma susceptibility gene, its genotype and expression showing associations with incidence and severity. The balancing selection acting on ZFPM2 may relate to its roles in multiple organ development or associated disease etiology.
25025186 screened a larger CTD population, which comprised 145 tetralogy of Fallot (TOF), 37 double-outlet ventricle outflow (DORV), and 18 transposition of the great artery (TGA), to investigate exon mutations as well as copy number variations in ZFPM2/FOG2
24769157 Findings indicate that zinc finger protein, multitype 2 protein (ZFPM2) plays a role in diaphragm and cardiovascular development.
24743694 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24702427 Isolated congenital diaphragmatic hernia was the predominant phenotype observed in our ZFPM2 mutation patients.
24549039 Whole exome sequencing identified independent missense mutations in FOG2 in two patients with 46,XY gonadal dysgenesis.
24469719 our results provide strong evidence regarding the susceptibility of the ZFPM2 gene to the development of non-syndromic TOF/DORV.
24179092 FOG1, FOG2 and GATA-6 modulate the transcriptional up-regulation of HAMP in hepatocytes during inflammation.
23029311 Sex Cord Stromal Tumors in childhood exhibited an embryonal gonadal phenotype, expressing a FOG-2/GATA-4 pattern in keeping with embryonal gonads.
21947317 association of the ZFPM2 SNP, rs12678719, with antipsychotic-induced parkinsonism
21919901 Variants of the ZFPM2/FOG2 gene might be a common cause of Double outlet right ventricle.
20807224 New mutations in ZFPM2/FOG2 gene in tetralogy of Fallot and double outlet right ventricle
20807224 Observational study of gene-disease association. (HuGE Navigator)
20705609 These results implicate FOG1 and 2 and CTBPs as partners of GATA proteins in the control of adipocyte proliferation and differentiation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20005803 Comparative analyses identify USH and its human homolog, FOG2, as the targets of fly miR-8 and human miR-200, respectively; USH/FOG2 inhibits PI3K activity, suppressing cell growth in both flies and humans.
18658259 SERCA2 is an important target of FOG-2 and that increased FOG-2 expression may contribute to a decline in cardiac function in end-stage heart failure by impaired T3 signaling
17568391 sequence variation in diaphragmatic hernia
17309641 FOG-2 affects not only cardiac development but also gonadal function and its preservation
15705784 AML1-FOG2 and FOG2-AML1 are expressed in myelodysplastic syndrome; results suggest a central role for CtBP in AML1-FOG2 transcriptional repression and implicate coordinated disruption of AML1 and GATA developmental programs in the disease pathogenesis
15643620 Observational study of gene-disease association. (HuGE Navigator)
12606418 FOG-2 has specific role in fetal ovaries counteracting transactivation of mullerian-inhibiting substance gene by GATA-4. Important role for FOG-2 and GATA transcription factors in developing ovary.

AA Sequence

MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDE      1 - 70
GIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLPVGTTWGPFPGKMDLNNNSL     71 - 140
KTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQLWCTTTKAISEGEELIAFVVDFDSRLQAAS    141 - 210
QMTLTEGMYPARLLDSIQLLPQQAAMASILPTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREA    211 - 280
APVSEENEDSAHQISSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINF    281 - 350
HQHLFSHLTQAAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL    351 - 420
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLASSPVQPNIGP    421 - 490
SFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIYSPLMPKGATCFECNITFNNL    491 - 560
DNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTGQTSINLLNPAAHSADPENPLLQTSCINSST    561 - 630
VLDLIGPNGKGHDKDFSTQTKKLSTSSNNDDKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHE    631 - 700
TYMVHKQYYCATRHDPPLKRSASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPC    701 - 770
TSTQEPTEGLGECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS    771 - 840
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPESERNSPDVSYE    841 - 910
RSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRHLFLPQCLYPGAIKKAKGADQ    911 - 980
LSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQ    981 - 1050
DERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKY   1051 - 1120
CRLCDIQFNNLSNFITHKKFYCSSHAAEHVK                                          1121 - 1151
//

Text Mined References (43)

PMID Year Title
26207917 2015 Glioma Association and Balancing Selection of ZFPM2.
25025186 2014 Novel missense variants of ZFPM2/FOG2 identified in conotruncal heart defect patients do not impair interaction with GATA4.
24769157 Exome sequencing identifies ZFPM2 as a cause of familial isolated congenital diaphragmatic hernia and possibly cardiovascular malformations.
24743694 2014 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24702427 2015 Prevalence and penetrance of ZFPM2 mutations and deletions causing congenital diaphragmatic hernia.
24549039 2014 Mutations in the FOG2/ZFPM2 gene are associated with anomalies of human testis determination.
24469719 2014 Identification of novel significant variants of ZFPM2/FOG2 in non-syndromic Tetralogy of Fallot and double outlet right ventricle in a Chinese Han population.
24179092 2013 Friend of GATA and GATA-6 modulate the transcriptional up-regulation of hepcidin in hepatocytes during inflammation.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23226341 2012 SUMOylation regulates the transcriptional repression activity of FOG-2 and its association with GATA-4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029311 2012 GATA-4 and FOG-2 expression in pediatric ovarian sex cord-stromal tumors replicates embryonal gonadal phenotype: results from the TREP project.
22570617 2012 Common variants at 9p21 and 8q22 are associated with increased susceptibility to optic nerve degeneration in glaucoma.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21947317 2012 Association of the ZFPM2 gene with antipsychotic-induced parkinsonism in schizophrenia patients.
21919901 2012 Novel ZFPM2/FOG2 variants in patients with double outlet right ventricle.
21757650 2011 Identification of cis- and trans-acting genetic variants explaining up to half the variation in circulating vascular endothelial growth factor levels.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21220346 2011 Loss-of-function mutation in GATA4 causes anomalies of human testicular development.
20807224 2011 New mutations in ZFPM2/FOG2 gene in tetralogy of Fallot and double outlet right ventricle.
20705609 2010 GATA proteins work together with friend of GATA (FOG) and C-terminal binding protein (CTBP) co-regulators to control adipogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20206639 2010 The transcription factor GATA-4 regulates cytochrome P4502C19 gene expression.
20005803 2009 Conserved MicroRNA miR-8/miR-200 and its target USH/FOG2 control growth by regulating PI3K.
19723756 2009 A missense GATA3 mutation, Thr272Ile, causes the hypoparathyroidism, deafness, and renal dysplasia syndrome.
18658259 2008 Increased FOG-2 in failing myocardium disrupts thyroid hormone-dependent SERCA2 gene transcription.
17568391 2007 Candidate genes for congenital diaphragmatic hernia from animal models: sequencing of FOG2 and PDGFRalpha reveals rare variants in diaphragmatic hernia patients.
17309641 2007 Disruption of friend of GATA 2 gene (FOG-2) by a de novo t(8;10) chromosomal translocation is associated with heart defects and gonadal dysgenesis.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16103912 2005 Fog2 is required for normal diaphragm and lung development in mice and humans.
15705784 2005 AML1-FOG2 fusion protein in myelodysplasia.
15643620 2005 ZFPM2/FOG2 and HEY2 genes analysis in nonsyndromic tricuspid atresia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220332 2004 FOG-2 competes with GATA-4 for transcriptional coactivator p300 and represses hypertrophic responses in cardiac myocytes.
14517948 2003 Mutations of ZFPM2/FOG2 gene in sporadic cases of tetralogy of Fallot.
12606418 2003 FOG-2 and GATA-4 Are coexpressed in the mouse ovary and can modulate mullerian-inhibiting substance expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11297508 2001 Proper coronary vascular development and heart morphogenesis depend on interaction of GATA-4 with FOG cofactors.
10438528 1999 hFOG-2, a novel zinc finger protein, binds the co-repressor mCtBP2 and modulates GATA-mediated activation.
10329627 1999 Transcriptional cofactors of the FOG family interact with GATA proteins by means of multiple zinc fingers.
9927675 1999 Molecular cloning of FOG-2: a modulator of transcription factor GATA-4 in cardiomyocytes.